KEGG   Mycobacterium tuberculosis H37Rv: Rv3001cHelp
Entry
Rv3001c           CDS       T00015                                 

Gene name
ilvC
Definition
(RefSeq) ketol-acid reductoisomerase
  KO
K00053  ketol-acid reductoisomerase [EC:1.1.1.86]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
mtu00290  Valine, leucine and isoleucine biosynthesis
mtu00770  Pantothenate and CoA biosynthesis
mtu01100  Metabolic pathways
mtu01110  Biosynthesis of secondary metabolites
mtu01130  Biosynthesis of antibiotics
mtu01210  2-Oxocarboxylic acid metabolism
mtu01230  Biosynthesis of amino acids
Module
mtu_M00019  Valine/isoleucine biosynthesis, pyruvate => valine / 2-oxobutanoate => isoleucine
mtu_M00570  Isoleucine biosynthesis, threonine => 2-oxobutanoate => isoleucine
Brite
KEGG Orthology (KO) [BR:mtu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00290 Valine, leucine and isoleucine biosynthesis
    Rv3001c (ilvC)
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    Rv3001c (ilvC)
Enzymes [BR:mtu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.86  ketol-acid reductoisomerase (NADP+)
     Rv3001c (ilvC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IlvN IlvC 2-Hacid_dh_C NAD_binding_2 F420_oxidored AdoHcyase_NAD
Motif
Other DBs
NCBI-GeneID: 887483
NCBI-ProteinID: NP_217517
TubercuList: Rv3001c
UniProt: P9WKJ7
Structure
PDB: 

Position
complement(3359585..3360586)
Genome map
AA seq 333 aa AA seqDB search
MFYDDDADLSIIQGRKVGVIGYGSQGHAHSLSLRDSGVQVRVGLKQGSRSRPKVEEQGLD
VDTPAEVAKWADVVMVLAPDTAQAEIFAGDIEPNLKPGDALFFGHGLNVHFGLIKPPADV
AVAMVAPKGPGHLVRRQFVDGKGVPCLVAVEQDPRGDGLALALSYAKAIGGTRAGVIKTT
FKDETETDLFGEQTVLCGGTEELVKAGFEVMVEAGYPAELAYFEVLHELKLIVDLMYEGG
LARMYYSVSDTAEFGGYLSGPRVIDAGTKERMRDILREIQDGSFVHKLVADVEGGNKQLE
ELRRQNAEHPIEVVGKKLRDLMSWVDRPITETA
NT seq 1002 nt NT seq  +upstreamnt  +downstreamnt
atgttctacgacgacgacgcagacctgtcgatcattcagggccgcaaggttggtgtgatc
ggctacggcagccaggggcacgcgcactcgctaagcctgcgcgactcgggtgtgcaggtg
cgcgtcgggctgaagcagggttcgcggtcgcggcccaaggtagaagagcagggcctggac
gtcgacactcccgccgaggtcgccaaatgggccgatgtggtcatggtgttggcccccgac
accgcccaggccgagatcttcgcaggagacatcgaacccaacctcaagcccggtgacgcg
ctgttcttcggtcacggactcaacgttcacttcggcttgatcaagccgcccgccgacgtc
gccgtcgcgatggtcgccccgaagggaccgggtcatttggtgcgccgccagttcgtcgac
ggcaagggtgtgccgtgtttggttgcggtagagcaggatccgcgaggcgacggcttggcg
ctggcgctgtcgtatgccaaagcgatcggcggcacccgggccggcgtcatcaagacgacg
ttcaaagacgagaccgaaaccgacctgttcggtgagcaaacggtgttgtgcggcggcacc
gaggaattggtcaaggccgggttcgaggtcatggtcgaagccggctaccccgcggaattg
gcctacttcgaggtgctgcacgagctgaagctgatcgtcgacttgatgtacgagggtggc
ctggcgcggatgtactactcggtgtcggacaccgcggaattcggcggctacctctcaggc
ccgcgcgtcatcgatgccggcaccaaggagcggatgcgcgacatcctgcgggagatccag
gacggtagctttgtccacaagctggtcgccgacgtcgagggcggcaacaaacagctcgaa
gagttgcgccggcaaaacgccgagcaccccatcgaggtcgtcggcaagaaactccgcgac
ctgatgagctgggtggaccgcccgatcaccgagacggcctag

DBGET integrated database retrieval system