KEGG   Mycobacterium tuberculosis H37Rv: Rv3002cHelp
Entry
Rv3002c           CDS       T00015                                 

Gene name
ilvN
Definition
(RefSeq) acetolactate synthase small subunit
  KO
K01653  acetolactate synthase I/III small subunit [EC:2.2.1.6]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
mtu00290  Valine, leucine and isoleucine biosynthesis
mtu00650  Butanoate metabolism
mtu00660  C5-Branched dibasic acid metabolism
mtu00770  Pantothenate and CoA biosynthesis
mtu01100  Metabolic pathways
mtu01110  Biosynthesis of secondary metabolites
mtu01130  Biosynthesis of antibiotics
mtu01210  2-Oxocarboxylic acid metabolism
mtu01230  Biosynthesis of amino acids
Module
mtu_M00019  Valine/isoleucine biosynthesis, pyruvate => valine / 2-oxobutanoate => isoleucine
mtu_M00570  Isoleucine biosynthesis, threonine => 2-oxobutanoate => isoleucine
Brite
KEGG Orthology (KO) [BR:mtu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    Rv3002c (ilvN)
   00660 C5-Branched dibasic acid metabolism
    Rv3002c (ilvN)
  09105 Amino acid metabolism
   00290 Valine, leucine and isoleucine biosynthesis
    Rv3002c (ilvN)
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    Rv3002c (ilvN)
Enzymes [BR:mtu01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.6  acetolactate synthase
     Rv3002c (ilvN)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ALS_ss_C ACT_5 ACT ACT_4 Saccharop_dh_N ACT_6 THOC7 PPR_long
Motif
Other DBs
NCBI-GeneID: 887226
NCBI-ProteinID: NP_217518
TubercuList: Rv3002c
UniProt: P9WKJ3 I6XFW7
Position
complement(3360624..3361130)
Genome map
AA seq 168 aa AA seqDB search
MSPKTHTLSVLVEDKPGVLARVAALFSRRGFNIESLAVGATECKDRSRMTIVVSAEDTPL
EQITKQLNKLINVIKIVEQDDEHSVSRELALIKVQADAGSRSQVIEAVNLFRANVIDVSP
ESLTVEATGNRGKLEALLRVLEPFGIREIAQSGMVSLSRGPRGIGTAK
NT seq 507 nt NT seq  +upstreamnt  +downstreamnt
atgagcccgaagacgcacacgttgtcggtgttggtcgaagacaagcccggcgtgctggcg
cgggtggcggcgctgttctcccggcgcggtttcaacatcgagtcgttggcggtgggtgcc
accgagtgcaaggacaggtcacggatgaccatcgtggtctccgccgaggacactccgctc
gagcagatcaccaagcagctcaacaagctgatcaacgtcatcaagatcgtcgagcaggac
gacgagcactcggtgtcacgggaattggcgctcatcaaggtccaagccgacgccggcagc
cgcagccaagtgatcgaagcggtgaatctgtttcgcgccaacgtgattgacgtatccccg
gagtcattgaccgtcgaggccaccggtaaccgcggcaagttagaggccctgctgcgggtg
ttggagccgttcggtattcgcgaaatcgcccaatccggaatggtgtcgctgtcccgcggt
ccgcgcggcatcggcaccgccaagtag

DBGET integrated database retrieval system