KEGG   Mycobacterium tuberculosis H37Rv: Rv3025cHelp
Entry
Rv3025c           CDS       T00015                                 

Gene name
iscS
Definition
(RefSeq) cysteine desulfurase
  KO
K04487  cysteine desulfurase [EC:2.8.1.7]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
mtu00730  Thiamine metabolism
mtu01100  Metabolic pathways
mtu04122  Sulfur relay system
Brite
KEGG Orthology (KO) [BR:mtu00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    Rv3025c (iscS)
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04122 Sulfur relay system
    Rv3025c (iscS)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:mtu03016]
    Rv3025c (iscS)
   03029 Mitochondrial biogenesis [BR:mtu03029]
    Rv3025c (iscS)
  09183 Protein families: signaling and cellular processes
   02048 Prokaryotic Defense System [BR:mtu02048]
    Rv3025c (iscS)
Enzymes [BR:mtu01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.1  Sulfurtransferases
    2.8.1.7  cysteine desulfurase
     Rv3025c (iscS)
Transfer RNA biogenesis [BR:mtu03016]
 Eukaryotic Type
  tRNA modification factors
   Thiolation factors
    Rv3025c (iscS)
 Prokaryotic Type
    Rv3025c (iscS)
Mitochondrial biogenesis [BR:mtu03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Proteins involved in Fe-S cluster biogenesis
    Rv3025c (iscS)
Prokaryotic defense system [BR:mtu02048]
 DNA phosphothiolation system
  Sulfur modification proteins
   Rv3025c (iscS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_5 Beta_elim_lyase Aminotran_3
Motif
Other DBs
NCBI-GeneID: 887677
NCBI-ProteinID: NP_217541
TubercuList: Rv3025c
UniProt: P9WQ71 I6Y2B3
Structure
PDB: 

Position
complement(3383885..3385066)
Genome map
AA seq 393 aa AA seqDB search
MAYLDHAATTPMHPAAIEAMAAVQRTIGNASSLHTSGRSARRRIEEARELIADKLGARPS
EVIFTAGGTESDNLAVKGIYWARRDAEPHRRRIVTTEVEHHAVLDSVNWLVEHEGAHVTW
LPTAADGSVSATALREALQSHDDVALVSVMWANNEVGTILPIAEMSVVAMEFGVPMHSDA
IQAVGQLPLDFGASGLSAMSVAGHKFGGPPGVGALLLRRDVTCVPLMHGGGQERDIRSGT
PDVASAVGMATAAQIAVDGLEENSARLRLLRDRLVEGVLAEIDDVCLNGADDPMRLAGNA
HFTFRGCEGDALLMLLDANGIECSTGSACTAGVAQPSHVLIAMGVDAASARGSLRLSLGH
TSVEADVDAALEVLPGAVARARRAALAAAGASR
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atggcctacctggatcacgctgccaccaccccgatgcaccccgccgccatcgaggcgatg
gcggccgtgcagcgcaccatcggcaatgcgtcgtcgctgcacaccagcgggcgctcggcg
cgccggcggatcgaggaggcccgtgagctgatcgcggacaagctaggcgctcgtccgtcc
gaggtgatcttcaccgcgggcggcaccgaaagcgacaacctggctgtcaaaggtatctat
tgggcacgccgcgatgcggagccgcaccgccgtcgcatcgtcaccaccgaggtggaacac
cacgccgtactggactcggtgaactggctcgtggaacacgaaggcgcccatgtgacctgg
ctgccgaccgccgccgacggctcggtgtcggcaactgcgctgcgcgaggcactgcagagc
cacgacgacgtcgcgctggtatcggtgatgtgggccaacaacgaggtcggaactattcta
ccgatcgccgaaatgtcagttgtcgccatggaattcggcgtgccgatgcacagtgatgcc
attcaggcggtgggacagctcccgcttgacttcggggccagcgggctgtcggcgatgagc
gtggccgggcacaaattcggtggcccgccaggagtgggtgcgttgctgctgcgccgcgac
gtcacctgcgtgccccttatgcacggcggtgggcaggagcgcgatattcgttccggcaca
cccgatgtcgccagtgcagttggaatggcgacggccgcgcagatcgcggtggacggactc
gaggaaaacagcgcgcggttacggctgctgcgggatcgtctggtcgagggtgtgctggct
gagattgacgatgtttgccttaacggcgccgatgacccgatgcggctagcgggtaacgcg
cacttcactttccgtggctgcgaaggcgatgcgctgttgatgttgttggacgctaacgga
atcgagtgctcaaccggatcggcctgcacggcaggtgtagcgcagccctcgcatgtgttg
attgcaatgggcgtcgacgcggccagcgcccgcggatcattgcgtctctcgctggggcac
accagtgttgaggctgatgtcgatgccgcgttggaggtgcttcccggggcggtggcacgt
gcacggcgggccgccctagccgccgcgggagcatcccgatga

DBGET integrated database retrieval system