KEGG   Mycobacterium tuberculosis H37Rv: Rv3042cHelp
Entry
Rv3042c           CDS       T00015                                 

Gene name
serB2
Definition
(RefSeq) phosphoserine phosphatase SerB
  KO
K01079  phosphoserine phosphatase [EC:3.1.3.3]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
mtu00260  Glycine, serine and threonine metabolism
mtu00680  Methane metabolism
mtu01100  Metabolic pathways
mtu01120  Microbial metabolism in diverse environments
mtu01130  Biosynthesis of antibiotics
mtu01200  Carbon metabolism
mtu01230  Biosynthesis of amino acids
Module
mtu_M00020  Serine biosynthesis, glycerate-3P => serine
Brite
KEGG Orthology (KO) [BR:mtu00001]
 09100 Metabolism
  09102 Energy metabolism
   00680 Methane metabolism
    Rv3042c (serB2)
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Rv3042c (serB2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatase and associated proteins [BR:mtu01009]
    Rv3042c (serB2)
Enzymes [BR:mtu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.3  phosphoserine phosphatase
     Rv3042c (serB2)
Protein phosphatases and associated proteins [BR:mtu01009]
 HAD phosphatases
  Other HAD phosphatases
   Rv3042c (serB2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HAD ACT_6 Hydrolase Hydrolase_3 ACT S6PP HAD_2 ACT_7 Put_Phosphatase Toxin_ToxA DUF705 Acid_PPase
Motif
Other DBs
NCBI-GeneID: 887815
NCBI-ProteinID: NP_217558
TubercuList: Rv3042c
UniProt: O53289
Position
complement(3401933..3403162)
Genome map
AA seq 409 aa AA seqDB search
MPAKVSVLITVTGMDQPGVTSALFEVLAQHGVELLNVEQVVIRGRLTLGVLVSCPLDVAD
GTALRDDVAAAIHGVGLDVAIERSDDLPIIRQPSTHTIFVLGRPITAGAFSAVARGVAAL
GVNIDFIRGISDYPVTGLELRVSVPPGCVGPLQIALTKVAAEEHVDVAVEDYGLAWRTKR
LIVFDVDSTLVQGEVIEMLAARAGAQGQVAAITEAAMRGELDFAESLQRRVATLAGLPAT
VIDDVAEQLELMPGARTTIRTLRRLGFRCGVVSGGFRRIIEPLARELMLDFVASNELEIV
DGILTGRVVGPIVDRPGKAKALRDFASQYGVPMEQTVAVGDGANDIDMLGAAGLGIAFNA
KPALREVADASLSHPYLDTVLFLLGVTRGEIEAADAGDCGVRRVEIPAD
NT seq 1230 nt NT seq  +upstreamnt  +downstreamnt
atgccagccaaggtgtcggtgctgatcacggtcaccggcatggatcagccaggcgtgaca
tccgcgctcttcgaggtgctcgcgcagcacggagtcgagctgctcaacgtcgaacaagtg
gtgatccggggccggctcacgctgggtgtgctggtgtcgtgcccgctggacgttgccgac
ggtaccgcgctgcgcgacgacgtcgcggccgccatccacggggtgggtctagacgtcgcc
atcgagcgcagcgacgatctgccaatcattcggcaaccgtccacccacaccattttcgtg
ctgggacgcccgattaccgccggagcgttcagcgcggtggccaggggagtggccgcactc
ggcgtcaacatcgacttcatccgcggcatttccgactacccggtcaccggcctggagttg
cgggtctcggtgccgcctggatgcgtgggtccgctgcagatcgccctgaccaaggtggcc
gccgaagagcatgtcgatgtggccgtcgaggactacggcttggcttggcgcaccaaacgc
ctgatcgtcttcgacgtcgactccactctggtccaaggcgaggtcatcgagatgctggca
gcccgtgcgggtgcccagggacaggtcgccgcgatcaccgaggccgcgatgcgtggtgag
ctggacttcgccgagtcgctgcagcgtcgtgttgccaccttggcggggctgcccgcgacg
gtgatagacgacgtcgccgagcagctcgaactgatgcccggtgctcggaccacgatccgg
accttgcggcgtctgggttttcgctgcggtgtggtttccggcggctttcggcggatcatc
gagccgctcgcacgcgagttgatgttggatttcgttgcgtccaacgagctggaaatcgtc
gatggcattcttaccggccgggtcgtggggccgattgttgaccggcccggcaaggccaag
gcgcttcgggacttcgcgagccagtatggggtgccgatggagcagaccgtcgcggtcggc
gacggcgccaacgatatcgacatgctgggcgcggccgggctgggaatagcattcaacgcc
aagccggcgttgcgtgaggtcgccgatgcgtcgttgagccatccgtacctggacacggtg
ttgttcttgttgggcgtgactcgcggtgagatcgaggccgccgacgccggcgactgtggg
gtgcgtcgcgtcgaaatcccggccgactag

DBGET integrated database retrieval system