KEGG   Mycobacterium tuberculosis H37Rv: Rv3045Help
Entry
Rv3045            CDS       T00015                                 

Gene name
adhC
Definition
(RefSeq) NADP-dependent alcohol dehydrogenase
  KO
K13979  uncharacterized zinc-type alcohol dehydrogenase-like protein [EC:1.-.-.-]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Brite
KEGG Orthology (KO) [BR:mtu00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    Rv3045 (adhC)
Enzymes [BR:mtu01000]
 1. Oxidoreductases
  1.-  
   1.-.-  
    1.-.-.-  
     Rv3045 (adhC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 AlaDh_PNT_C 2-Hacid_dh_C NAD_binding_7 3HCDH_N
Motif
Other DBs
NCBI-GeneID: 888888
NCBI-ProteinID: NP_217561
TubercuList: Rv3045
UniProt: P9WQC5 I6XG08
Position
3406285..3407325
Genome map
AA seq 346 aa AA seqDB search
MSTVAAYAAMSATEPLTKTTITRRDPGPHDVAIDIKFAGICHSDIHTVKAEWGQPNYPVV
PGHEIAGVVTAVGSEVTKYRQGDRVGVGCFVDSCRECNSCTRGIEQYCKPGANFTYNSIG
KDGQPTQGGYSEAIVVDENYVLRIPDVLPLDVAAPLLCAGITLYSPLRHWNAGANTRVAI
IGLGGLGHMGVKLGAAMGADVTVLSQSLKKMEDGLRLGAKSYYATADPDTFRKLRGGFDL
ILNTVSANLDLGQYLNLLDVDGTLVELGIPEHPMAVPAFALALMRRSLAGSNIGGIAETQ
EMLNFCAEHGVTPEIELIEPDYINDAYERVLASDVRYRFVIDISAL
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atgagcactgttgccgcctacgccgccatgtcggcgaccgaacccctgaccaagaccacg
atcacccgtcgcgacccgggcccgcacgacgtggcgatcgacatcaagttcgccggaatc
tgtcactcggacatccataccgtcaaagccgagtggggccaaccgaattaccctgtggtc
cctggccacgagatcgccggcgtggtgaccgccgtgggctcggaggtgaccaagtaccgg
cagggcgaccgcgttggggttggctgtttcgtggactcgtgccgcgagtgcaacagttgc
acgcgcggcatcgaacagtactgcaagccgggcgcaaacttcacctacaactcgatcggc
aaagacggccagccaacccagggcggctacagcgaagcgatcgtcgtcgacgaaaactac
gtgttgcgcatacccgacgtgctgcccctggatgtggcggcgccgctgttgtgcgcgggc
atcacgctgtactcgccactgcgccactggaatgccggggcgaacacgcgggtggcgatc
atcggcctaggcggactgggtcacatgggcgtcaagctgggcgccgcgatgggcgccgac
gtgacggtgctgtcccaatcgctgaagaaaatggaggacggtctgcgcttgggggccaag
agctactacgcgaccgccgacccggacaccttccgcaagctgcgcggcggcttcgacctg
atcctgaacaccgtctcggctaacttggacctcggccagtacctgaacctgctggacgtc
gacggcacactcgtggaactgggtatccccgagcaccccatggccgtgccggcgttcgcg
ctagcgctcatgcgacgcagcctggccgggtccaacatcggcgggatcgccgagacccag
gagatgctcaatttctgtgccgagcacggcgtgacacccgaaatcgagctgattgaaccg
gactacatcaacgacgcctacgagcgcgtgctggccagcgacgtgcgctaccgcttcgtc
atcgacatctcagccctgtga

DBGET integrated database retrieval system