KEGG   Mycobacterium tuberculosis H37Rv: Rv3051cHelp
Entry
Rv3051c           CDS       T00015                                 

Gene name
nrdE
Definition
(RefSeq) ribonucleoside-diphosphate reductase subunit alpha
  KO
K00525  ribonucleoside-diphosphate reductase alpha chain [EC:1.17.4.1]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
mtu00230  Purine metabolism
mtu00240  Pyrimidine metabolism
mtu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mtu00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    Rv3051c (nrdE)
   00240 Pyrimidine metabolism
    Rv3051c (nrdE)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:mtu03400]
    Rv3051c (nrdE)
Enzymes [BR:mtu01000]
 1. Oxidoreductases
  1.17  Acting on CH or CH2 groups
   1.17.4  With a disulfide as acceptor
    1.17.4.1  ribonucleoside-diphosphate reductase
     Rv3051c (nrdE)
DNA repair and recombination proteins [BR:mtu03400]
 Prokaryotic Type
  Other factors with a suspected DNA repair function
   Modulation of nucleotide pools
    Rv3051c (nrdE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribonuc_red_lgC RNR_N Ribonuc_red_lgN Fib_succ_major T4bSS_IcmS
Motif
Other DBs
NCBI-GeneID: 888869
NCBI-ProteinID: NP_217567
TubercuList: Rv3051c
UniProt: P9WH75 I6YF20
Position
complement(3412085..3414166)
Genome map
AA seq 693 aa AA seqDB search
MLNLYDADGKIQFDKDREAAHQYFLQHVNQNTVFFHNQDEKLDYLIRENYYEREVLDQYS
RNFVKTLLDRAYAKKFRFPTFLGAFKYYTSYTLKTFDGKRYLERFEDRVVMVALTLAAGD
TALAELLVDEIIDGRFQPATPTFLNSGKKQRGEPVSCFLLRVEDNMESIGRSINSALQLS
KRGGGVALLLTNIREHGAPIKNIENQSSGVIPIMKLLEDAFSYANQLGARQGAGAVYLHA
HHPDIYRFLDTKRENADEKIRIKTLSLGVVIPDITFELAKRNDDMYLFSPYDVERVYGVP
FADISVTEKYYEMVDDARIRKTKIKAREFFQTLAELQFESGYPYIMFEDTVNRANPIDGK
ITHSNLCSEILQVSTPSLFNEDLSYAKVGKDISCNLGSLNIAKTMDSPDFAQTIEVAIRA
LTAVSDQTHIKSVPSIEQGNNDSHAIGLGQMNLHGYLARERIFYGSDEGIDFTNIYFYTV
LYHALRASNRIAIERGTHFKGFERSKYASGEFFDKYTDQIWEPKTQKVRQLFADAGIRIP
TQDDWRRLKESVQAHGIYNQNLQAVPPTGSISYINHSTSSIHPIVSKVEIRKEGKIGRVY
YPAPYMTNDNLEYYEDAYEIGYEKIIDTYAAATQHVDQGLSLTLFFKDTATTRDVNKAQI
YAWRKGIKTLYYIRLRQMALEGTEVEGCVSCML
NT seq 2082 nt NT seq  +upstreamnt  +downstreamnt
atgctgaacctgtacgacgcggacggcaagatccagttcgacaaggatcgggaagcagcc
caccagtactttttgcagcatgtcaatcagaacacggtcttcttccataatcaggacgag
aagctcgactacctgatccgcgagaattactacgagcgtgaggttctcgaccagtactcg
cgcaacttcgtcaagacgctgctagaccgcgcctacgccaaaaagttccggtttccgacg
tttttgggtgcgttcaagtactacacctcctacacgctgaaaacctttgacgggaagcgc
tatctggagcgcttcgaggaccgcgtggtcatggtggcgctaacgttggccgccggcgat
accgcacttgccgagctgctggtcgacgagatcatcgacggccgcttccagcccgccaca
ccgacgtttttgaattctggcaagaagcagcgcggggagcccgtgagctgttttttgctt
cgcgtcgaagacaacatggagtcgatcggacggtcgatcaactccgcgctgcagctatcc
aagcgtggcgggggagtggcgttgctgctgaccaacattcgcgagcacggcgcgccgatc
aagaacatcgagaaccagtcctcgggcgtcatccccatcatgaagttgctggaggatgcg
ttctcctacgccaaccagctgggcgctcgtcaaggtgccggcgcggtgtacctgcacgcc
catcaccccgacatctaccgattcctggacaccaagcgtgagaacgccgacgagaagatc
cggatcaagacgctgagtctgggggtggtgatccccgacatcaccttcgagttggccaag
cgcaacgatgacatgtacctgttctcgccctacgatgtcgagcgggtctacggtgtgccg
ttcgctgacatctcggtcaccgagaagtactacgaaatggtcgatgacgcgcgcatccgc
aagaccaagatcaaggcacgggagttcttccagacgctggccgagctgcagttcgagtcc
ggctacccctatatcatgttcgaagacaccgtcaatcgcgctaatccaattgatggcaag
atcacgcacagcaacctgtgctcggagatcctgcaagtgtctacgccgtcattgttcaac
gaggacttgtcgtatgccaaagtgggcaaagacatttcgtgcaacctggggtcgctgaac
atcgccaagacgatggactcgccggacttcgcgcagacgatcgaggtggcgatccgcgcg
ttgaccgcggtgagcgaccaaacccatatcaagtcggtgccctcaatcgagcagggcaac
aacgactcccacgcgatcgggctaggacagatgaacctgcacggctacctggcccgggaa
cgcatcttctacggatccgacgaaggcatcgacttcaccaacatctacttctatacggtg
ctgtatcacgcgttgcgggcatccaaccgcatcgcgatcgaacgcggcacgcacttcaag
ggtttcgagcggtccaagtacgcgtccggggaattcttcgacaagtacaccgaccagatt
tgggagccgaagacccagaaggtacgccagctgttcgccgacgccggcatccgcatccca
acgcaggacgactggcgtcggctcaaggagtcggtgcaagcgcacggcatctacaaccag
aacctgcaggcggtgccgccgaccgggtcgatttcctacatcaaccattcgacgtcgtcg
attcacccgatcgtgtcgaaggtcgagatccgcaaggaaggcaagatcgggcgggtctac
tacccggcgccgtatatgaccaacgacaacctggagtactacgaagacgcctacgagatc
ggttacgagaagatcatcgacacctacgcggcggccacccagcatgtggatcaagggctt
tcgctgacgttgttcttcaaagacaccgccaccacccgcgacgtgaacaaggcgcagatt
tacgcctggcgcaaggggatcaagacgctgtactacatccggctgcggcagatggcgttg
gagggcaccgaggtcgagggttgcgtgtcctgcatgctgtag

DBGET integrated database retrieval system