KEGG   Mycobacterium tuberculosis H37Rv: Rv3068cHelp
Entry
Rv3068c           CDS       T00015                                 

Gene name
pgmA
Definition
(RefSeq) phosphoglucomutase PgmA
  KO
K01835  phosphoglucomutase [EC:5.4.2.2]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
mtu00010  Glycolysis / Gluconeogenesis
mtu00030  Pentose phosphate pathway
mtu00052  Galactose metabolism
mtu00230  Purine metabolism
mtu00500  Starch and sucrose metabolism
mtu00520  Amino sugar and nucleotide sugar metabolism
mtu00521  Streptomycin biosynthesis
mtu01100  Metabolic pathways
mtu01110  Biosynthesis of secondary metabolites
mtu01120  Microbial metabolism in diverse environments
mtu01130  Biosynthesis of antibiotics
Module
mtu_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:mtu00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Rv3068c (pgmA)
   00030 Pentose phosphate pathway
    Rv3068c (pgmA)
   00052 Galactose metabolism
    Rv3068c (pgmA)
   00500 Starch and sucrose metabolism
    Rv3068c (pgmA)
   00520 Amino sugar and nucleotide sugar metabolism
    Rv3068c (pgmA)
  Nucleotide metabolism
   00230 Purine metabolism
    Rv3068c (pgmA)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Rv3068c (pgmA)
Enzymes [BR:mtu01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     Rv3068c (pgmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PGM_PMM_I PGM_PMM_III PGM_PMM_II PGM_PMM_IV
Motif
Other DBs
NCBI-GeneID: 888826
NCBI-ProteinID: NP_217584
TubercuList: Rv3068c
UniProt: I6Y2G3
Position
complement(3431979..3433622)
Genome map
AA seq 547 aa AA seqDB search
MVANPRAGQPAQPEDLVDLPHLVTAYYSIEPDPDDLAQQVAFGTSGHRGSALTGTFNELH
ILAITQAIVEYRAAQGTTGPLFIGRDTHGLSEPAWVSALEVLAANQVVAVVDSRDRYTPT
PAISHAILTYNRGRTEALADGIVVTPSHNPPSDGGIKYNPPNGGPADTAATTAIAKRANE
ILLARSMVKRLPLARALRTAQRHDYLGHYVDDLPNVVDIAAIREAGVRIGADPLGGASVD
YWGEIAHRHGLDLTVVNPLVDATWRFMTLDTDGKIRMDCSSPDAMAGLIRTMFGNRERYQ
IATGNDADADRHGIVTPDEGLLNPNHYLAVAIEYLYTHRPSWPAGIAVGKTVVSSSIIDR
VVAGIGRQLVEVPVGFKWFVDGLIGATLGFGGEESAGASFLRRDGSVWTTDKDGIIMALL
AAEILAVTGATPSQRYHALAGEYGGPCYARIDAPADREQKARLARLSADQVSATELAGEP
ITAKLTTAPGNGAALGGLKVTTANAWFAARPSGTEDVYKIYAESFRGPQHLVEVQQTARE
VVDRVIG
NT seq 1644 nt NT seq  +upstreamnt  +downstreamnt
atggtggccaacccacgagccggtcaaccggcccagcccgaagacctcgtcgacctgccc
catctggtgactgcgtactactcgatcgaacccgatcccgacgacctcgctcaacaggtc
gctttcggcacctcagggcaccggggctcagccctgaccggaacgttcaacgaactacat
attctggccatcacccaggctatcgtcgaataccgcgccgcccaggggaccaccgggccg
ctgttcatcggccgtgacacccatggcctttcggaaccggcatgggtatcggcgctggag
gtactcgccgccaatcaggtggtggccgtcgtcgactcccgcgaccgctacacgccgacg
ccggcaatcagccacgccatcttgacctacaaccgcggccggaccgaagcgctggccgac
gggatcgttgtgacgccgtcgcacaacccgccgtccgacggcggcatcaagtacaaccca
cccaacggtggcccggcggacaccgctgcgaccaccgcaatagccaagcgtgccaacgag
attctgctcgctcggtcgatggtgaagcggttgccgctggcccgcgcgttacgcaccgcc
cagcgacacgactacctgggccactatgtcgatgacctgccgaacgtggtcgatatcgcc
gccattcgcgaggccggggtgcggatcggcgccgacccgctcggcggggccagcgtggat
tactggggtgagatcgcccaccggcatggcctagacctgaccgtggtcaatccgctggtc
gacgcaacctggcggttcatgaccctggacaccgacgggaagatccggatggactgcagt
tcaccggatgcgatggctgggctcatccgaacgatgttcggcaaccgggagcgctaccag
atcgccaccggcaacgacgccgacgccgaccgacacggcatagtcacccctgacgaaggg
ctgctgaatcctaaccactatctggccgtggccatcgaatatctctacacccaccgcccg
tcctggccggccggcatcgccgtgggcaagacggtggtcagctcgtcgatcatcgaccgg
gtggtcgccgggatcggccgtcaactcgttgaggtaccggtcggattcaaatggttcgtc
gacggtctgatcggcgccaccttgggcttcggcggcgaggaatcggcgggggcatcattt
ctgcgacgggacggatcggtatggaccaccgacaaggacggcatcatcatggcgctgctg
gccgccgagatcctggcggtcaccggggctacgccgtcgcagcgatatcacgcgctggcc
ggcgagtacggtgggccgtgctatgcgcggatcgacgcgcccgccgatcgggagcagaaa
gcccgcctggccaggctgtcggccgaccaggtgagcgccaccgagttggccggtgagccg
atcaccgcaaagctgacgaccgcgcccggcaacggtgctgcgctgggcggattgaaggtg
acgacggccaatgcgtggtttgccgcgcgtccgtcgggcaccgaggacgtctacaagatc
tacgcggagtccttccgtggaccgcaacatctggtcgaggtgcagcagaccgcccgcgaa
gtggtcgatcgggtcatcgggtga

DBGET integrated database retrieval system