KEGG   Mycobacterium tuberculosis H37Rv: Rv3130cHelp
Entry
Rv3130c           CDS       T00015                                 

Gene name
tgs1
Definition
(RefSeq) diacyglycerol O-acyltransferase
  KO
K00635  diacylglycerol O-acyltransferase / wax synthase [EC:2.3.1.20 2.3.1.75]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
mtu00561  Glycerolipid metabolism
mtu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mtu00001]
 09100 Metabolism
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    Rv3130c (tgs1)
Enzymes [BR:mtu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.20  diacylglycerol O-acyltransferase
     Rv3130c (tgs1)
    2.3.1.75  long-chain-alcohol O-fatty-acyltransferase
     Rv3130c (tgs1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: WES_acyltransf DUF1298 AATase
Motif
Other DBs
NCBI-GeneID: 888841
NCBI-ProteinID: NP_217646
TubercuList: Rv3130c
UniProt: P9WKC9 I6X6F1
Position
complement(3494975..3496366)
Genome map
AA seq 463 aa AA seqDB search
MNHLTTLDAGFLKAEDVDRHVSLAIGALAVIEGPAPDQEAFLSSLAQRLRPCTRFGQRLR
LRPFDLGAPKWVDDPDFDLGRHVWRIALPRPGNEDQLFELIADLMARRLDRGRPLWEVWV
IEGLADSKWAILTKLHHCMADGIAATHLLAGLSDESMSDSFASNIHTTMQSQSASVRRGG
FRVNPSEALTASTAVMAGIVRAAKGASEIAAGVLSPAASSLNGPISDLRRYSAAKVPLAD
VEQVCRKFDVTINDVALAAITESYRNVLIQRGERPRFDSLRTLVPVSTRSNSALSKTDNR
VSLMLPNLPVDQENPLQRLRIVHSRLTRAKAGGQRQFGNTLMAIANRLPFPMTAWAVGLL
MRLPQRGVVTVATNVPGPRRPLQIMGRRVLDLYPVSPIAMQLRTSVAMLSYADDLYFGIL
ADYDVVADAGQLARGIEDAVARLVAISKRRKVTRRRGALSLVV
NT seq 1392 nt NT seq  +upstreamnt  +downstreamnt
atgaatcacctaacgacacttgacgccgggtttctcaaggcagaagacgtggatcggcac
gtgagtctggcaatcggcgctctggcggtcatcgaggggccggctcccgatcaggaagcc
ttcttatcgtcgctcgctcaacgcctacgtccctgtacccggttcgggcagcggttacgc
ctgcgcccgttcgacctcggtgcacccaaatgggtggacgatcccgacttcgatcttggc
cgtcatgtgtggcgcatcgccttgccgcggcctggcaacgaagaccagttattcgagctg
atcgccgatctgatggcgcgtcgtttggaccggggtcgaccgctgtgggaggtctgggtc
atcgaaggcctggcggacagcaagtgggcgatcctgaccaaactgcaccactgcatggcc
gacggaatcgcggcgactcacctgctagctgggctctccgatgaaagtatgagcgacagc
ttcgcgagcaacatccacacgaccatgcagtcgcaatccgcatctgtgcggcggggtgga
ttccgtgtcaatccaagcgaggcgttgaccgcgtcgaccgccgtgatggcaggcatcgtt
cgcgcggccaagggtgccagtgagatcgcggccggcgtgctaagtcccgccgcgtcgtcg
ttgaacgggccgatcagtgatttgcgtcgctacagcgcagcaaaggtccctctcgccgac
gtcgaacaggtgtgccggaaattcgacgtcaccatcaatgatgttgcgcttgccgcgatt
acggaaagctaccgcaacgtcctcatccagcggggtgagcggcctaggtttgattcgctg
cgtacgctagtgccggtctcgacgcgttccaacagcgctttgagcaagaccgataaccgt
gtttcgttaatgctgcccaacctgccggtggatcaagagaacccgctgcagcggctgcgg
atcgtgcactcgcggctgactcgggccaaggcggggggacagagacaattcggaaatact
ttgatggcgattgccaaccgccttccgttccccatgaccgcatgggcggtcgggctgttg
atgcggctgccgcagcgtggtgttgtcaccgtggcgacaaatgtgccgggtccacgacgg
ccgctgcagattatgggcagacgggtgcttgacctatacccggtttcgccgatcgcgatg
caactgcgcaccagtgtcgcgatgctcagctacgccgacgacctgtacttcgggatcctg
gccgactacgacgtggtagcagatgccggccagctggcgcgaggaattgaagacgccgtc
gcacggctggtggcgatcagtaagcggcgcaaggtgactcgcaggcgcggagcgctatcg
ctggttgtgtga

DBGET integrated database retrieval system