KEGG   Mycobacterium tuberculosis H37Rv: Rv3145Help
Entry
Rv3145            CDS       T00015                                 

Gene name
nuoA
Definition
(RefSeq) NADH-quinone oxidoreductase subunit A
  KO
K00330  NADH-quinone oxidoreductase subunit A [EC:7.1.1.2]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
mtu00190  Oxidative phosphorylation
mtu01100  Metabolic pathways
Module
mtu_M00144  NADH:quinone oxidoreductase, prokaryotes
Brite
KEGG Orthology (KO) [BR:mtu00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    Rv3145 (nuoA)
Enzymes [BR:mtu01000]
 7. Translocases
  7.1  Catalysing the translocation of hydrons
   7.1.1  Linked to oxidoreductase reactions
    7.1.1.2  NADH:ubiquinone reductase (H+-translocating)
     Rv3145 (nuoA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Oxidored_q4 DUF2888
Motif
Other DBs
NCBI-GeneID: 887397
NCBI-ProteinID: NP_217661
TubercuList: Rv3145
UniProt: P9WIW7 I6YBB8
Position
3511682..3512068
Genome map
AA seq 128 aa AA seqDB search
MNVYIPILVLAALAAAFAVVSVVIASLVGPSRFNRSKQAAYECGIEPASTGARTSIGPGA
ASGQRFPIKYYLTAMLFIVFDIEIVFLYPWAVSYDSLGTFALVEMAIFMLTVFVAYAYVW
RRGGLTWD
NT seq 387 nt NT seq  +upstreamnt  +downstreamnt
ttgaacgtctacatacccatcctggtactggcggcgctggccgccgccttcgccgtggtg
tcggtggtgatcgcgagcctggtcggcccgtcgcggttcaaccggtcaaagcaggccgcc
tacgaatgcgggatcgagcccgctagcactggagccagaacctccattggccccggcgcg
gcgagcgggcagcggttccccatcaagtactacctgaccgcgatgttgttcatcgtcttc
gacatcgaaattgtgttcctctacccgtgggcggtcagctacgactcgctgggcacgttc
gcgctggtcgagatggcgatattcatgctcacggtgttcgtggcctacgcgtatgtgtgg
cgccgcgggggcctgacgtgggattga

DBGET integrated database retrieval system