KEGG   Mycobacterium tuberculosis H37Rv: Rv3206cHelp
Entry
Rv3206c           CDS       T00015                                 

Gene name
moeB1
Definition
(RefSeq) adenylyltransferase/sulfurtransferase MoeZ
  KO
K21147  sulfur-carrier protein adenylyltransferase/sulfurtransferase [EC:2.7.7.80 2.7.7.- 2.8.1.11 2.8.1.-]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
mtu04122  Sulfur relay system
Brite
KEGG Orthology (KO) [BR:mtu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04122 Sulfur relay system
    Rv3206c (moeB1)
Enzymes [BR:mtu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.80  molybdopterin-synthase adenylyltransferase
     Rv3206c (moeB1)
    2.7.7.-  
     Rv3206c (moeB1)
  2.8  Transferring sulfur-containing groups
   2.8.1  Sulfurtransferases
    2.8.1.11  molybdopterin synthase sulfurtransferase
     Rv3206c (moeB1)
    2.8.1.-  
     Rv3206c (moeB1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ThiF Rhodanese Shikimate_DH SelB-wing_3 TIP39 DAO Sacchrp_dh_NADP UDPG_MGDP_dh_N
Motif
Other DBs
NCBI-GeneID: 888871
NCBI-ProteinID: YP_177942
TubercuList: Rv3206c
UniProt: P9WMN7 I6X6P0
Position
complement(3582532..3583710)
Genome map
AA seq 392 aa AA seqDB search
MSTSLPPLVEPASALSREEVARYSRHLIIPDLGVDGQKRLKNARVLVIGAGGLGAPTLLY
LAAAGVGTIGIVDFDVVDESNLQRQVIHGVADVGRSKAQSARDSIVAINPLIRVRLHELR
LAPSNAVDLFKQYDLILDGTDNFATRYLVNDAAVLAGKPYVWGSIYRFEGQASVFWEDAP
DGLGVNYRDLYPEPPPPGMVPSCAEGGVLGIICASVASVMGTEAIKLITGIGETLLGRLL
VYDALEMSYRTITIRKDPSTPKITELVDYEQFCGVVADDAAQAAKGSTITPRELRDWLDS
GRKLALIDVRDPVEWDIVHIDGAQLIPKSLINSGEGLAKLPQDRTAVLYCKTGVRSAEAL
AAVKKAGFSDAVHLQGGIVAWAKQMQPDMVMY
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
gtgtcgacatccttgccgccactagttgagccagcatccgcgctcagccgtgaagaggta
gctcgctacagccgccatctcatcattcctgacctgggtgttgacgggcagaagaggctc
aagaacgcgcgagtactggtgatcggcgccggcgggctcggagcgcccacgttattgtat
ctggccgccgccggcgtcggcaccatcggcatcgtcgacttcgatgtggttgacgagtcg
aacctgcagcgccaggtcatccatggggtagctgacgtcgggcgctccaaggctcagtcg
gcgcgcgattcgattgtcgcgatcaacccgctgatccgggtgcgactacacgagctgcgg
cttgcgccgagcaacgccgtcgacctgttcaagcagtacgacctgatcttggatggcacc
gacaacttcgccacccggtatctggtcaacgacgccgcggtgctggctggcaagccgtac
gtgtgggggtcgatttaccgcttcgagggccaggcatcggtgttttgggaggacgccccc
gacgggttgggtgtcaactaccgcgacctgtatcccgagccgccgccgccgggcatggtg
ccgtcctgtgctgaaggcggggtgctgggcattatctgtgcctcggtcgcatcggtgatg
ggcactgaggcgatcaagctgatcaccgggataggtgaaacactgcttggccggttgctg
gtgtacgacgcgctggagatgagctatcgcacgatcaccatccgcaaggacccatcgaca
ccgaagatcaccgagctggtcgactacgaacagttctgcggcgtggttgctgacgatgcc
gcccaggcggccaaaggttccaccatcacgccgcgcgagctgcgcgactggctggactcc
ggccgtaagctggcactgatcgacgttcgcgatcccgtggagtgggacatcgtgcatatc
gacggagcccaactgattccgaaatcgttgatcaactcgggtgagggtctggccaagctc
ccccaggaccgcaccgccgtgctgtactgcaagacgggcgtgcgctcggccgaggcattg
gctgcggtcaagaaagccggtttctccgacgcggtacacctgcagggtgggatcgtcgcg
tgggccaagcagatgcagcccgacatggtgatgtactag

DBGET integrated database retrieval system