KEGG   Mycobacterium tuberculosis H37Rv: Rv3214Help
Entry
Rv3214            CDS       T00015                                 

Gene name
gpm2
Definition
(RefSeq) phosphoglycerate mutase
Organism
mtu  Mycobacterium tuberculosis H37Rv
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1 Reo_sigma1
Motif
Other DBs
NCBI-GeneID: 888830
NCBI-ProteinID: YP_177944
TubercuList: Rv3214
UniProt: Q6MWZ7
Structure
PDB: 

Position
3591646..3592257
Genome map
AA seq 203 aa AA seqDB search
MGVRNHRLLLLRHGETAWSTLGRHTGGTEVELTDTGRTQAELAGQLLGELELDDPIVICS
PRRRTLDTAKLAGLTVNEVTGLLAEWDYGSYEGLTTPQIRESEPDWLVWTHGCPAGESVA
QVNDRADSAVALALEHMSSRDVLFVSHGHFSRAVITRWVQLPLAEGSRFAMPTASIGICG
FEHGVRQLAVLGLTGHPQPIAAG
NT seq 612 nt NT seq  +upstreamnt  +downstreamnt
atgggcgtgcgcaaccaccgattgctactgctccgccacggcgagaccgcttggtcgacg
ctgggccggcacaccggcggtaccgaggtcgagctgaccgataccgggcgaacgcaggca
gagctggctggtcagctgctgggtgaactcgaacttgacgacccgattgtcatctgtagc
ccgcgtcgacggacgttggatactgccaagttggccggcctgacggtgaatgaggtaact
gggctgctcgccgaatgggattacggttcctatgagggccttacgacgccgcagatccgg
gaatccgaacccgattggctggtgtggacgcacggctgcccagctggagaaagcgtcgca
caggtaaacgatcgcgctgacagcgccgtcgcgctggccctggagcacatgtcctcacgc
gacgtgttgtttgtcagccatggccacttctcccgcgcggtgatcacgcgctgggtccag
ctaccgctcgccgaaggcagccgtttcgcgatgcccaccgcctcgatcgggatctgcggg
ttcgagcacggcgtgcgtcagctcgccgtgctcgggttgaccggtcatccgcagccgatc
gcagccgggtga

DBGET integrated database retrieval system