KEGG   Mycobacterium tuberculosis H37Rv: Rv3215Help
Entry
Rv3215            CDS       T00015                                 

Gene name
entC
Definition
(RefSeq) isochorismate synthase
  KO
K02361  isochorismate synthase [EC:5.4.4.2]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
mtu00130  Ubiquinone and other terpenoid-quinone biosynthesis
mtu01053  Biosynthesis of siderophore group nonribosomal peptides
mtu01100  Metabolic pathways
mtu01110  Biosynthesis of secondary metabolites
mtu01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:mtu00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00130 Ubiquinone and other terpenoid-quinone biosynthesis
    Rv3215 (entC)
  09109 Metabolism of terpenoids and polyketides
   01053 Biosynthesis of siderophore group nonribosomal peptides
    Rv3215 (entC)
Enzymes [BR:mtu01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.4  Transferring hydroxy groups
    5.4.4.2  isochorismate synthase
     Rv3215 (entC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Chorismate_bind
Motif
Other DBs
NCBI-GeneID: 888824
NCBI-ProteinID: NP_217731
TubercuList: Rv3215
UniProt: P9WFW9 I6X6P9
Position
3592254..3593372
Genome map
AA seq 372 aa AA seqDB search
MSAHVATLHPEPPFALCGPRGTLIARGVRTRYCDVRAAQAALRSGTAPILLGALPFDVSR
PAALMVPDGVLRARKLPDWPTGPLPKVRVAAALPPPADYLTRIGRARDLLAAFDGPLHKV
VLARAVQLTADAPLDARVLLRRLVVADPTAYGYLVDLTSAGNDDTGAALVGASPELLVAR
SGNRVMCKPFAGSAPRAADPKLDAANAAALASSAKNRHEHQLVVDTMRVALEPLCEDLTI
PAQPQLNRTAAVWHLCTAITGRLRNISTTAIDLALALHPTPAVGGVPTKAATELIAELEG
DRGFYAGAVGWCDGRGDGHWVVSIRCAQLSADRRAALAHAGGGIVAESDPDDELEETTTK
FATILTALGVEQ
NT seq 1119 nt NT seq  +upstreamnt  +downstreamnt
gtgagcgcacacgtggcaaccttgcacccagaaccaccgttcgcactgtgcggaccaaga
ggcaccctgattgcccgcggggtgcggacacgatactgcgacgtgcgggccgcgcaagcg
gcacttcgctcaggtacagcaccaatactgttgggcgcgttgcctttcgacgtgagcaga
cccgccgcattgatggtgccggatggcgtgctgcgggcccggaagctgcctgactggccg
accggcccgctgcccaaggtacgcgtcgccgccgcccttccgccacctgccgactacctg
acccggatcggccgcgcacgggatctgctggccgccttcgacggcccgttgcacaaagtg
gtgctcgcgcgcgccgtgcaactgaccgccgatgctccgctggacgcgcgggtactgttg
cgcaggttggtcgtcgccgacccgaccgcttacggctatctcgtcgacctcacctctgcg
ggcaacgacgacaccggggcagccctggtcggcgccagcccagagcttctggtcgcacga
tccggcaatcgcgtcatgtgcaagccatttgccggctcagccccacgcgccgccgacccc
aaactcgacgccgccaacgcggccgcactagccagttcggccaagaaccgacacgaacac
caattggtcgtcgacacgatgcgggtagccctagagccactatgcgaggacctgacaatc
ccagcccagccccagttgaaccgcaccgcagccgtttggcatctgtgcaccgcgatcacc
ggccggctgcgcaacatctcgacgacggcaatcgatctggctttggcgctacatcccacc
ccggcggttggtggggtcccgacaaaagctgccaccgagctcatcgccgaactcgagggc
gaccgtggcttctacgccggcgcggttggttggtgcgacggccggggcgacggccattgg
gtggtgtctatccggtgcgcgcaactttcggctgatcgacgcgcagcccttgcgcacgct
ggcggtggcatcgtcgccgaatcagaccccgatgacgaacttgaagaaaccacaacgaag
ttcgccacgatattgaccgcactgggagttgagcagtga

DBGET integrated database retrieval system