KEGG   Mycobacterium tuberculosis H37Rv: Rv3227Help
Entry
Rv3227            CDS       T00015                                 

Gene name
aroA
Definition
(RefSeq) 3-phosphoshikimate 1-carboxyvinyltransferase
  KO
K00800  3-phosphoshikimate 1-carboxyvinyltransferase [EC:2.5.1.19]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
mtu00400  Phenylalanine, tyrosine and tryptophan biosynthesis
mtu01100  Metabolic pathways
mtu01110  Biosynthesis of secondary metabolites
mtu01130  Biosynthesis of antibiotics
mtu01230  Biosynthesis of amino acids
Module
mtu_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:mtu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Rv3227 (aroA)
Enzymes [BR:mtu01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.19  3-phosphoshikimate 1-carboxyvinyltransferase
     Rv3227 (aroA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: EPSP_synthase
Motif
Other DBs
NCBI-GeneID: 888753
NCBI-ProteinID: NP_217744
TubercuList: Rv3227
UniProt: P9WPY5 I6YBK0
Structure
PDB: 

Position
3603377..3604729
Genome map
AA seq 450 aa AA seqDB search
MKTWPAPTAPTPVRATVTVPGSKSQTNRALVLAALAAAQGRGASTISGALRSRDTELMLD
ALQTLGLRVDGVGSELTVSGRIEPGPGARVDCGLAGTVLRFVPPLAALGSVPVTFDGDQQ
ARGRPIAPLLDALRELGVAVDGTGLPFRVRGNGSLAGGTVAIDASASSQFVSGLLLSAAS
FTDGLTVQHTGSSLPSAPHIAMTAAMLRQAGVDIDDSTPNRWQVRPGPVAARRWDIEPDL
TNAVAFLSAAVVSGGTVRITGWPRVSVQPADHILAILRQLNAVVIHADSSLEVRGPTGYD
GFDVDLRAVGELTPSVAALAALASPGSVSRLSGIAHLRGHETDRLAALSTEINRLGGTCR
ETPDGLVITATPLRPGIWRAYADHRMAMAGAIIGLRVAGVEVDDIAATTKTLPEFPRLWA
EMVGPGQGWGYPQPRSGQRARRATGQGSGG
NT seq 1353 nt NT seq  +upstreamnt  +downstreamnt
gtgaagacatggccagccccaacggcgccgacgccggtgcgcgctaccgtgaccgttcca
ggctcgaagtcgcagaccaaccgggcgctggtgctagcggcgctggcggccgcacaaggc
cggggcgcatcgaccatctccggcgcgctgcgcagccgcgacaccgaactgatgctggac
gcgctgcagaccctgggcctgcgcgtcgacggtgtgggttcggaactgacggtcagcggc
cgaatcgaaccggggcccggcgctcgggtggactgtggcttggcgggcacggtgttgcgg
tttgttccgccgctggcggcgctgggctccgtcccggtcaccttcgacggcgatcagcaa
gcccggggacggcccatcgcaccgctgctggatgcgctgcgcgagctcggcgtcgccgtc
gacggcaccggtctaccgtttcgggttcgcggcaacgggtcgctcgccggcggcaccgtg
gccatcgacgcgtcggcgtcctcacagttcgtgtccgggctgctgctgtccgcggcatcg
ttcaccgatggcctgaccgtccaacacaccggttcgtcgctgccgtctgcgccgcacatc
gcgatgacggcggcgatgctgcggcaagccggagtcgacatcgacgactcgacaccgaac
cgttggcaggtgcgccccggtccggtggcggcgcggcgctgggacatcgaaccggacctg
accaacgcggtggctttcctgtcagcggccgtggtcagcggcggcaccgtgcgcatcacc
ggctggcctagagtcagcgtgcaacccgccgaccacatcttggcaattttgcggcagctc
aatgccgttgtcattcatgctgattcatccctcgaggtgcgcggtccaacgggatacgac
gggtttgacgtcgacttgcgcgccgtcggcgagctgacgccatcggtcgcggcgctggcg
gcgctggcatccccgggatcggtgtccagactaagcggcattgcccatctgcggggccac
gaaaccgaccggctcgccgcgctgagcaccgagatcaaccggttggggggcacctgccgg
gaaacacccgacggtctggtgatcaccgcgacgccgttgcggcccggcatctggcgggca
tacgcggaccatcgaatggcgatggccggcgcgatcattgggctgcgggtggccggagtc
gaggtcgacgacatcgccgccaccaccaagacgctgccggagtttccgcggctgtgggcc
gagatggtcggacccggccaggggtgggggtacccccagccgcgcagcggccagcgggcg
aggcgggcaaccgggcaggggtccggcggttga

DBGET integrated database retrieval system