KEGG   Mycobacterium tuberculosis H37Rv: Rv3247cHelp
Entry
Rv3247c           CDS       T00015                                 

Gene name
tmk
Definition
(RefSeq) thymidylate kinase
  KO
K00943  dTMP kinase [EC:2.7.4.9]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
mtu00240  Pyrimidine metabolism
mtu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mtu00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    Rv3247c (tmk)
Enzymes [BR:mtu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.9  dTMP kinase
     Rv3247c (tmk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thymidylate_kin AAA_28 ArgK AAA_18 dNK MobB DUF2075 SRP54 AAA_33 AAA_30
Motif
Other DBs
NCBI-GeneID: 888740
NCBI-ProteinID: NP_217764
TubercuList: Rv3247c
UniProt: P9WKE1 I6YBL6
Structure
PDB: 

Position
complement(3627419..3628063)
Genome map
AA seq 214 aa AA seqDB search
MLIAIEGVDGAGKRTLVEKLSGAFRAAGRSVATLAFPRYGQSVAADIAAEALHGEHGDLA
SSVYAMATLFALDRAGAVHTIQGLCRGYDVVILDRYVASNAAYSAARLHENAAGKAAAWV
QRIEFARLGLPKPDWQVLLAVSAELAGERSRGRAQRDPGRARDNYERDAELQQRTGAVYA
ELAAQGWGGRWLVVGADVDPGRLAATLAPPDVPS
NT seq 645 nt NT seq  +upstreamnt  +downstreamnt
gtgctaatcgcgattgagggcgttgacggcgctggcaagcggacgttggtggaaaagctg
tccggggcctttcgagcagccgggagatcggtggccacactggcgttcccgcgctacgga
cagtcggtggccgccgacatcgcagcggaggcgctgcacggcgagcacggtgacctcgca
tcgtcggtgtatgcgatggcgacgctgttcgcgctcgaccgcgctggcgcggtccacacg
atccaggggctgtgtcgcggctacgacgtggtgatcctggatcgctacgtcgcctccaac
gcggcctacagcgcggcgcgcctacatgaaaacgcggccgggaaggcagcggcctgggtt
cagcggatcgaatttgcaagactcgggttgcccaagcccgactggcaggtgctccttgcg
gtctctgccgagctcgccggggaacgatcccgcggccgtgcccagcgtgaccccggtcgg
gcgcgcgacaattacgaacgcgacgctgaacttcagcagcgcaccggtgcggtctacgcc
gagttggcggcccaagggtggggcggccggtggctggttgtcggcgccgatgttgatccg
ggccgactagcggcgactttggcgcctccagacgtgccaagttga

DBGET integrated database retrieval system