KEGG   Mycobacterium tuberculosis H37Rv: Rv3248cHelp
Entry
Rv3248c           CDS       T00015                                 

Gene name
sahH
Definition
(RefSeq) adenosylhomocysteinase
  KO
K01251  adenosylhomocysteinase [EC:3.3.1.1]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
mtu00270  Cysteine and methionine metabolism
mtu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mtu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    Rv3248c (sahH)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:mtu01009]
    Rv3248c (sahH)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mtu04147]
    Rv3248c (sahH)
Enzymes [BR:mtu01000]
 3. Hydrolases
  3.3  Acting on ether bonds
   3.3.1  Thioether and trialkylsulfonium hydrolases
    3.3.1.1  adenosylhomocysteinase
     Rv3248c (sahH)
Protein phosphatases and associated proteins [BR:mtu01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Rv3248c (sahH)
Exosome [BR:mtu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Rv3248c (sahH)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AdoHcyase AdoHcyase_NAD 2-Hacid_dh_C IlvN TrkA_N NAD_binding_7 Shikimate_DH THF_DHG_CYH_C XdhC_C F420_oxidored AlaDh_PNT_C RNase_PH_C Gp_dh_N
Motif
Other DBs
NCBI-GeneID: 888746
NCBI-ProteinID: NP_217765
TubercuList: Rv3248c
UniProt: P9WGV3 I6Y309
Structure
PDB: 

Position
complement(3628160..3629647)
Genome map
AA seq 495 aa AA seqDB search
MTGNLVTKNSLTPDVRNGIDFKIADLSLADFGRKELRIAEHEMPGLMSLRREYAEVQPLK
GARISGSLHMTVQTAVLIETLTALGAEVRWASCNIFSTQDHAAAAVVVGPHGTPDEPKGV
PVFAWKGETLEEYWWAAEQMLTWPDPDKPANMILDDGGDATMLVLRGMQYEKAGVVPPAE
EDDPAEWKVFLNLLRTRFETDKDKWTKIAESVKGVTEETTTGVLRLYQFAAAGDLAFPAI
NVNDSVTKSKFDNKYGTRHSLIDGINRGTDALIGGKKVLICGYGDVGKGCAEAMKGQGAR
VSVTEIDPINALQAMMEGFDVVTVEEAIGDADIVVTATGNKDIIMLEHIKAMKDHAILGN
IGHFDNEIDMAGLERSGATRVNVKPQVDLWTFGDTGRSIIVLSEGRLLNLGNATGHPSFV
MSNSFANQTIAQIELWTKNDEYDNEVYRLPKHLDEKVARIHVEALGGHLTKLTKEQAEYL
GVDVEGPYKPDHYRY
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
atgaccggaaatttggtgaccaaaaattcgctgacccctgacgttcgtaacggcatcgac
tttaagatcgccgacctgtcactagcggatttcggccgcaaagaactccggatcgccgag
cacgagatgcccggcctgatgtcgctgcggcgcgagtatgccgaggtgcaacccctgaag
ggggcccggatctcgggttcgctgcacatgacggtgcagaccgcggtgttgatcgaaacc
ctcaccgcgctgggcgccgaagtccgctgggcctcgtgcaacatcttctccacccaggat
cacgccgccgccgccgtcgtggtcggcccgcacggcacccccgacgagcccaagggtgtc
ccggtgttcgcgtggaagggcgagacgctcgaagagtactggtgggccgccgagcagatg
ctcacctggccggaccccgacaagccggccaacatgatcctcgatgacggcggtgacgcc
accatgttggtgctgcgcggcatgcagtatgagaaggccggcgtggtgccgcccgccgag
gaggacgaccccgccgagtggaaggtcttcctgaacctgctacggacccgcttcgagacc
gacaaggacaagtggaccaagatagccgagtcggtcaagggcgtcaccgaggagaccacc
accggcgtgctgcggctctaccaattcgccgcggccggggatctggccttcccggcgatc
aacgtcaacgactcggtgaccaagtccaaattcgacaacaagtacggcactcggcactcc
ctgatcgacggcatcaaccgcggcaccgacgcgctgatcggcggtaagaaggtcctcatc
tgcggctacggcgacgtcggtaagggctgtgcggaggcgatgaagggccagggagcgcgg
gtctccgtcaccgagatcgacccgatcaacgcgctgcaggccatgatggagggcttcgac
gtggtcaccgtcgaggaggccatcggggacgccgacatcgtcgtaaccgcgaccggcaac
aaagacatcatcatgctcgagcacattaaggcgatgaaggaccacgcgatcctgggaaat
atcggccacttcgacaacgagatcgacatggccgggctggagcgctccggggcgacacgg
gtcaacgtcaagcctcaggtcgacctgtggacctttggcgacacgggccgctcgatcatc
gtgctgtccgaggggcggctgctgaacctgggcaatgccaccgggcacccctcgttcgtg
atgagcaacagcttcgctaaccagacgatcgcccagatcgagctgtggaccaagaacgac
gagtacgacaacgaggtgtaccggctgcccaagcacctcgacgagaaggtggctcgaatc
catgtcgaggcccttggcggtcacctgaccaagctgaccaaggagcaggccgaatacctc
ggcgtcgacgtcgagggtccctacaagccggaccactaccgctactga

DBGET integrated database retrieval system