KEGG   Mycobacterium tuberculosis H37Rv: Rv3260cHelp
Entry
Rv3260c           CDS       T00015                                 

Gene name
whiB2
Definition
(RefSeq) transcriptional regulator WhiB2
  KO
K18955  WhiB family transcriptional regulator, redox-sensing transcriptional regulator
Organism
mtu  Mycobacterium tuberculosis H37Rv
Brite
KEGG Orthology (KO) [BR:mtu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mtu03000]
    Rv3260c (whiB2)
Transcription factors [BR:mtu03000]
 Prokaryotic Type
  Other transcription factors
   Others
    Rv3260c (whiB2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Whib
Motif
Other DBs
NCBI-GeneID: 888687
NCBI-ProteinID: NP_217777
TubercuList: Rv3260c
UniProt: O53353
Position
complement(3639872..3640141)
Genome map
AA seq 89 aa AA seqDB search
MVPEAPAPFEEPLPPEATDQWQDRALCAQTDPEAFFPEKGGSTREAKKICMGCEVRHECL
EYALAHDERFGIWGGLSERERRRLKRGII
NT seq 270 nt NT seq  +upstreamnt  +downstreamnt
ttggttcccgaggcgccggcgccattcgaggaacctctgccgccggaagccaccgaccaa
tggcaggaccgtgcgctatgtgcgcaaacggatcccgaagcgttcttcccggagaagggc
ggctccacgcgtgaggccaagaagatttgcatgggctgcgaggtgcggcacgagtgtctg
gagtacgccctggctcatgacgagcggttcggcatctggggtggtctttccgaacgcgag
cgccgccgcctcaaacgcgggatcatctga

DBGET integrated database retrieval system