KEGG   Mycobacterium tuberculosis H37Rv: Rv3261Help
Entry
Rv3261            CDS       T00015                                 

Gene name
fbiA
Definition
(RefSeq) 2-phospho-L-lactate transferase
  KO
K11212  LPPG:FO 2-phospho-L-lactate transferase [EC:2.7.8.28]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
mtu00680  Methane metabolism
mtu01120  Microbial metabolism in diverse environments
Module
mtu_M00378  F420 biosynthesis
Brite
KEGG Orthology (KO) [BR:mtu00001]
 09100 Metabolism
  09102 Energy metabolism
   00680 Methane metabolism
    Rv3261 (fbiA)
Enzymes [BR:mtu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.8  Transferases for other substituted phosphate groups
    2.7.8.28  2-phospho-L-lactate transferase
     Rv3261 (fbiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: UPF0052 AIMP2_LysRS_bd
Motif
Other DBs
NCBI-GeneID: 888701
NCBI-ProteinID: NP_217778
TubercuList: Rv3261
UniProt: P9WP81 I6X6U4
Position
3640543..3641538
Genome map
AA seq 331 aa AA seqDB search
MKVTVLAGGVGGARFLLGVQQLLGLGQFAANSAHSDADHQLSAVVNVGDDAWIHGLRVCP
DLDTCMYTLGGGVDPQRGWGQRDETWHAMQELVRYGVQPDWFELGDRDLATHLVRTQMLQ
AGYPLSQITEALCDRWQPGARLLPATDDRCETHVVITDPVDESRKAIHFQEWWVRYRAQV
PTHSFAFVGAEKSSAATEAIAALADADIIMLAPSNPVVSIGAILAVPGIRAALREATAPI
VGYSPIIGEKPLRGMADTCLSVIGVDSTAAAVGRHYGARCATGILDCWLVHDGDHAEIDG
VTVRSVPLLMTDPNATAEMVRAGCDLAGVVA
NT seq 996 nt NT seq  +upstreamnt  +downstreamnt
gtgaaggtcaccgttctggccggtggagtcggcggcgcccgcttcctgctcggggtccag
cagctgctcggcctgggccagtttgctgccaattctgcccactcggacgccgaccaccaa
ctgagcgctgtcgtcaacgtcggcgacgacgcctggatccacgggctgcgtgtctgcccg
gatctggacacctgcatgtataccctgggcggcggggtggacccccagcgcggctggggc
cagcgtgacgaaacttggcacgccatgcaggaactggtgcgctatggcgtgcagcccgac
tggttcgagctcggggaccgcgatctggccacccatctggtgcgcacccagatgctgcag
gccggctaccccctgtcacagatcaccgaggccctatgcgatcgctggcaaccgggcgcc
cgcttgctgcctgccaccgacgaccgttgcgaaacccatgtagtgatcaccgacccggtc
gacgaaagccgcaaggcgatccattttcaggagtggtgggtgcgctaccgtgcccaggtg
ccgacgcacagctttgcttttgtcggcgctgaaaagtccagcgctgcaaccgaagcgatc
gccgccctggccgacgccgacatcatcatgctggcgccgtctaatccggtggtcagcatc
ggcgccatcctggccgtccccgggattcgcgcggcgttgcgggaagcaaccgcaccgatc
gtcggctactcgccgatcatcggcgaaaagccgttgcgcggcatggccgatacgtgcctt
tcggttatcggggtggattccaccgcggccgctgtgggccggcactacggcgcgcggtgc
gccaccgggatactggactgctggctggtgcacgacggcgaccacgctgagattgacggg
gtgacggtgcggtcggtgccgctgctgatgaccgacccgaacgcgacggctgagatggtt
cgcgccgggtgcgaccttgcgggagtggtagcttga

DBGET integrated database retrieval system