KEGG   Mycobacterium tuberculosis H37Rv: Rv3264cHelp
Entry
Rv3264c           CDS       T00015                                 

Gene name
manB
Definition
(RefSeq) D-alpha-D-mannose-1-phosphate guanylyltransferase ManB
  KO
K00966  mannose-1-phosphate guanylyltransferase [EC:2.7.7.13]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
mtu00051  Fructose and mannose metabolism
mtu00520  Amino sugar and nucleotide sugar metabolism
mtu01100  Metabolic pathways
mtu01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mtu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    Rv3264c (manB)
   00520 Amino sugar and nucleotide sugar metabolism
    Rv3264c (manB)
Enzymes [BR:mtu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.13  mannose-1-phosphate guanylyltransferase
     Rv3264c (manB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 Hexapep DUF4954
Motif
Other DBs
NCBI-GeneID: 888715
NCBI-ProteinID: YP_177951
TubercuList: Rv3264c
UniProt: L7N6A5 L0TCA6
Position
complement(3644898..3645977)
Genome map
AA seq 359 aa AA seqDB search
MATHQVDAVVLVGGKGTRLRPLTLSAPKPMLPTAGLPFLTHLLSRIAAAGIEHVILGTSY
KPAVFEAEFGDGSALGLQIEYVTEEHPLGTGGGIANVAGKLRNDTAMVFNGDVLSGADLA
QLLDFHRSNRADVTLQLVRVGDPRAFGCVPTDEEDRVVAFLEKTEDPPTDQINAGCYVFE
RNVIDRIPQGREVSVEREVFPALLADGDCKIYGYVDASYWRDMGTPEDFVRGSADLVRGI
APSPALRGHRGEQLVHDGAAVSPGALLIGGTVVGRGAEIGPGTRLDGAVIFDGVRVEAGC
VIERSIIGFGARIGPRALIRDGVIGDGADIGARCELLSGARVWPGVFLPDGGIRYSSDV
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
ttggcaactcaccaagtcgatgcggtggtcctggtcggtggcaagggtacccgactgcgg
ccgttgacgctgtcggcgcccaagccaatgctgcctaccgccggactgccgttcctcacc
catctgctgtcgcggatcgccgcagcgggcatcgagcacgtgatcctgggtacgtcctac
aaacccgcagtcttcgaagcggagttcggcgacgggtccgcactgggcctacagatcgaa
tacgtgaccgaggagcatcccttggggactggcggcggcatcgccaacgttgccggcaag
ctgcgcaacgacaccgcgatggtgtttaacggcgatgtgctctcgggcgcggatctggcc
caactgctggacttccaccgaagcaatcgagccgatgtcacgctgcaactggtgcgggtg
ggcgacccgcgggcattcggctgcgtacccaccgacgaggaggaccgcgtagtcgccttt
ctggagaagacggaggatccgccgaccgaccagatcaatgccggctgctatgtcttcgaa
cgcaacgtcatcgaccggattccgcagggccgggaggtttcggtggaacgcgaggtgttc
ccggccttgctcgccgacggcgactgcaagatctacggctatgtcgatgccagctattgg
cgggacatgggcacaccggaagacttcgttcgcggatcggcggatctggtgcgcggcatc
gccccgtctccggccttgcgtggtcaccgcggtgagcagttggtgcacgacggtgcggcg
gtatctcccggtgcgttgctgattggcggcaccgtcgtggggcgtggtgccgaaatcggc
cccggcaccagattggacggcgcggtcatcttcgatggtgtccgggtggaggccgggtgc
gtgatcgagcgttcgatcatcggcttcggtgctcgcatcggaccgcgggcgttgatccgc
gacggtgtgatcggtgacggggccgacatcggcgcgcgctgcgagttgttaagtggtgcc
cgggtatggcccggtgtctttcttcccgacggcgggatccgttactcgtccgacgtttga

DBGET integrated database retrieval system