KEGG   Mycobacterium tuberculosis H37Rv: Rv3276cHelp
Entry
Rv3276c           CDS       T00015                                 

Gene name
purK
Definition
(RefSeq) 5-(carboxyamino)imidazole ribonucleotide synthase
  KO
K01589  5-(carboxyamino)imidazole ribonucleotide synthase [EC:6.3.4.18]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
mtu00230  Purine metabolism
mtu01100  Metabolic pathways
mtu01110  Biosynthesis of secondary metabolites
mtu01130  Biosynthesis of antibiotics
Module
mtu_M00048  Inosine monophosphate biosynthesis, PRPP + glutamine => IMP
Brite
KEGG Orthology (KO) [BR:mtu00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    Rv3276c (purK)
Enzymes [BR:mtu01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.18  5-(carboxyamino)imidazole ribonucleotide synthase
     Rv3276c (purK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp PurK_C CPSase_L_D2 GARS_A RimK Dala_Dala_lig_C ATP-grasp_2 ATP-grasp_3
Motif
Other DBs
NCBI-GeneID: 888720
NCBI-ProteinID: NP_217793
TubercuList: Rv3276c
UniProt: P9WHL9 I6YBN9
Position
complement(3658635..3659924)
Genome map
AA seq 429 aa AA seqDB search
MMAVASSRTPAVTSFIAPLVAMVGGGQLARMTHQAAIALGQNLRVLVTSADDPAAQVTPN
VVIGSHTDLAALRRVAAGADVLTFDHEHVPNELLEKLVADGVNVAPSPQALVHAQDKLVM
RQRLAAAGVAVPRYAGIKDPDEIDVFAARVDAPIVVKAVRGGYDGRGVRMARDVADARDF
ARECLADGVAVLVEERVDLRRELSALVARSPFGQGAAWPVVQTVQRDGTCVLVIAPAPAL
PDDLATAAQRLALQLADELGVVGVLAVELFETTDGALLVNELAMRPHNSGHWTIDGARTS
QFEQHLRAVLDYPLGDSDAVVPVTVMANVLGAAQPPAMSVDERLHHLFARMPDARVHLYG
KAERPGRKVGHINFLGSDVAQLCERAELAAHWLSHGRWTDGWDPHRASDDAVGVPPACGG
RSDEEERRL
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
atgatggccgtggcgagctcacgcaccccggcggtcacctcgttcattgcccccctcgtt
gcgatggtcggtggcggtcagctggcccggatgacccatcaggctgccatcgcgctgggg
cagaacctccgtgtattggtcacctcggcagatgaccctgccgcgcaggtcacccccaac
gtggtgatcggctcgcacaccgatcttgccgccttgcgccgcgttgcggccggcgccgac
gtgctgacctttgaccacgagcacgtcccgaacgagctgttggagaagctagtcgccgat
ggcgtcaatgtcgcaccgtcgccgcaggcgctggtgcacgcccaggacaaactcgtcatg
cggcagcgtctggctgcagcaggcgtcgccgtgccccgctacgcgggcatcaaagacccc
gacgaaatcgacgtcttcgccgcacgtgtcgacgccccgatcgtggtcaaggcagtgcgc
gggggttacgacggccggggcgttcggatggcacgtgatgtggcggatgcccgtgatttc
gctcgcgaatgcctggctgacggcgtggcggtgctggtcgaggaacgggtggacctgcgc
cgcgagctgtcggcactggtggcgcgttcgccgttcggccagggtgcggcgtggccggtg
gtccagacggtgcaacgtgacggcacgtgtgtgctggtgatcgcgccggcgccggcgctg
cccgacgacctggccaccgcggcgcaacggttggcgttgcagctggccgacgaactcggt
gtggtcggcgtgctcgccgtcgagctgttcgagacgaccgacggggcgttgctggtcaac
gagctcgcgatgcggccacataattccgggcactggaccatcgacggggcgcgcaccagc
cagttcgagcagcatctgcgcgcggtcttggactacccgctcggcgacagcgacgccgtg
gtgcccgtgacggtgatggccaatgtgctcggcgccgcgcagccgccggccatgagcgtc
gacgagcggctgcaccatctgtttgcgcgaatgcccgacgcccgggttcacctctacggc
aaggccgagcgacccggtcgcaaggtggggcatatcaacttccttggctccgatgtcgcc
cagttgtgtgaacgcgctgagctggcggcacactggttgtcccatgggcggtggactgac
ggatgggacccacaccgcgccagcgacgatgcagtgggggtaccacccgcgtgcggggga
cgaagcgatgaggaggagcggcgcctatga

DBGET integrated database retrieval system