KEGG   Mycobacterium tuberculosis H37Rv: Rv3303cHelp
Entry
Rv3303c           CDS       T00015                                 

Gene name
lpdA
Definition
(RefSeq) NAD(P)H quinone reductase LpdA
  KO
K00382  dihydrolipoamide dehydrogenase [EC:1.8.1.4]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
mtu00010  Glycolysis / Gluconeogenesis
mtu00020  Citrate cycle (TCA cycle)
mtu00260  Glycine, serine and threonine metabolism
mtu00280  Valine, leucine and isoleucine degradation
mtu00620  Pyruvate metabolism
mtu00630  Glyoxylate and dicarboxylate metabolism
mtu00640  Propanoate metabolism
mtu01100  Metabolic pathways
mtu01110  Biosynthesis of secondary metabolites
mtu01120  Microbial metabolism in diverse environments
mtu01130  Biosynthesis of antibiotics
mtu01200  Carbon metabolism
Module
mtu_M00009  Citrate cycle (TCA cycle, Krebs cycle)
mtu_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
mtu_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:mtu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Rv3303c (lpdA)
   00020 Citrate cycle (TCA cycle)
    Rv3303c (lpdA)
   00620 Pyruvate metabolism
    Rv3303c (lpdA)
   00630 Glyoxylate and dicarboxylate metabolism
    Rv3303c (lpdA)
   00640 Propanoate metabolism
    Rv3303c (lpdA)
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Rv3303c (lpdA)
   00280 Valine, leucine and isoleucine degradation
    Rv3303c (lpdA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mtu04147]
    Rv3303c (lpdA)
Enzymes [BR:mtu01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.4  dihydrolipoyl dehydrogenase
     Rv3303c (lpdA)
Exosome [BR:mtu04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   Rv3303c (lpdA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_dim Pyr_redox Pyr_redox_3 K_oxygenase Trp_halogenase GIDA HI0933_like FAD_oxidored Amino_oxidase Lycopene_cycl
Motif
Other DBs
NCBI-GeneID: 887659
NCBI-ProteinID: NP_217820
TubercuList: Rv3303c
UniProt: P9WHH7 I6XGU5
Structure
PDB: 

Position
complement(3689457..3690938)
Genome map
AA seq 493 aa AA seqDB search
MVTRIVILGGGPAGYEAALVAATSHPETTQVTVIDCDGIGGAAVLDDCVPSKTFIASTGL
RTELRRAPHLGFHIDFDDAKISLPQIHARVKTLAAAQSADITAQLLSMGVQVIAGRGELI
DSTPGLARHRIKATAADGSTSEHEADVVLVATGASPRILPSAQPDGERILTWRQLYDLDA
LPDHLIVVGSGVTGAEFVDAYTELGVPVTVVASQDHVLPYEDADAALVLEESFAERGVRL
FKNARAASVTRTGAGVLVTMTDGRTVEGSHALMTIGSVPNTSGLGLERVGIQLGRGNYLT
VDRVSRTLATGIYAAGDCTGLLPLASVAAMQGRIAMYHALGEGVSPIRLRTVAATVFTRP
EIAAVGVPQSVIDAGSVAARTIMLPLRTNARAKMSEMRHGFVKIFCRRSTGVVIGGVVVA
PIASELILPIAVAVQNRITVNELAQTLAVYPSLSGSITEAARRLMAHDDLDCTAAQDAAE
QLALVPHHLPTSN
NT seq 1482 nt NT seq  +upstreamnt  +downstreamnt
gtggtgacccgcatcgtgatcctcggtggcggcccggccggttacgaggccgcactggtg
gccgccacctcacacccggaaacaacccaagttaccgtgattgactgcgacggcatcggc
ggggctgccgtactggacgactgtgtgccgtcgaagacgttcatcgcctccaccgggctg
cgtaccgaactgcgccgagcgccgcacctgggctttcatatcgacttcgacgacgccaag
atctcgttgccgcaaatccatgcccgggtcaagacgctggccgccgcacagtcggccgac
atcaccgcccagctgctcagcatgggggttcaggtgatcgccggccggggcgagttgatc
gactccacaccgggtctggcgcgccatcgcattaaggcgaccgccgccgacggctccacc
agtgagcatgaggccgacgtcgtgctggtcgccaccggcgccagcccgcggatcctgccg
tcggcccagccggacggtgagcgcattctgacctggcggcagctctacgacttggacgcg
ttgcccgaccacctcatcgtggtgggctccggggttaccggtgctgagttcgtggacgcc
tataccgaattgggggtgccggtcacggtggtggccagccaggaccacgtgctgccgtat
gaggacgctgacgctgcgctggtcctggaagagtcgttcgccgaacggggagtccggctg
ttcaaaaatgcccgggcagcatcggtcacccgcaccggggccggggtgctcgtcacgatg
accgacggtcgcaccgtcgagggcagccacgccctgatgaccatcgggtcggtgcccaac
accagcggcctgggcctggaacgggtcggcatccagcttggccggggcaattacctgacc
gtggaccgggtgtcgcggacgttggcgaccggcatctacgccgcgggcgactgcacgggt
ttgctgcccctggcgtcggtcgccgcaatgcagggccgcatcgcgatgtaccacgcgctg
ggggagggcgtcagcccgatccggttacgcacggtggccgcgacggttttcaccaggccc
gagatcgccgcggtcggggtgccgcaatcggtcatcgacgccggttcggtggccgcccgg
accatcatgctgccgttacgaaccaacgcgcgcgccaagatgtcggagatgcgtcacggg
ttcgtcaagatcttctgccggcggtccaccggcgttgtgatcggcggcgtggtggtggcg
ccgatcgcatcggagctgatcctgcccatcgccgtagccgttcagaaccgcatcaccgtc
aacgagctggcccagacactggccgtttacccatcgttgtcgggttcgataaccgaggcg
gcccgccggctgatggcgcacgacgatctggactgcacggcagctcaagacgcggctgaa
caactagccttggtgccacaccacctaccgacgagtaactga

DBGET integrated database retrieval system