KEGG   Mycobacterium tuberculosis H37Rv: Rv3307Help
Entry
Rv3307            CDS       T00015                                 

Gene name
deoD
Definition
(RefSeq) purine nucleoside phosphorylase
  KO
K03783  purine-nucleoside phosphorylase [EC:2.4.2.1]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
mtu00230  Purine metabolism
mtu00240  Pyrimidine metabolism
mtu00760  Nicotinate and nicotinamide metabolism
mtu01100  Metabolic pathways
mtu01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mtu00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    Rv3307 (deoD)
   00240 Pyrimidine metabolism
    Rv3307 (deoD)
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    Rv3307 (deoD)
Enzymes [BR:mtu01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.1  purine-nucleoside phosphorylase
     Rv3307 (deoD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PNP_UDP_1
Motif
Other DBs
NCBI-GeneID: 887542
NCBI-ProteinID: NP_217824
TubercuList: Rv3307
UniProt: P9WP01 I6Y355
Structure
PDB: 

Position
3694054..3694860
Genome map
AA seq 268 aa AA seqDB search
MADPRPDPDELARRAAQVIADRTGIGEHDVAVVLGSGWLPAVAALGSPTTVLPQAELPGF
VPPTAAGHAGELLSVPIGAHRVLVLAGRIHAYEGHDLRYVVHPVRAARAAGAQIMVLTNA
AGGLRADLQVGQPVLISDHLNLTARSPLVGGEFVDLTDAYSPRLRELARQSDPQLAEGVY
AGLPGPHYETPAEIRMLQTLGADLVGMSTVHETIAARAAGAEVLGVSLVTNLAAGITGEP
LSHAEVLAAGAASATRMGALLADVIARF
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
gtggctgacccgcgccccgatcccgacgaactggcccggcgggcggcgcaggtcatcgct
gaccgcaccgggatcggcgaacatgacgtcgcggtcgtgctcgggtcgggatggttaccg
gccgttgcggcgttgggctccccgaccaccgtgctgccgcaggccgaactgcccgggttt
gtgccgccaaccgcagccgggcatgcgggcgagctactgtccgtgcccatcggtgcgcac
cgggtgctggtgctggccggtcgcatccacgcctacgagggacacgacctgcgctacgtc
gtgcatccggttcgggcggcccgtgcggcaggggcgcagattatggtgctcaccaacgcc
gccggtgggctgcgggcggaccttcaggtcggccagccggtgctgatcagcgatcacctg
aacctgaccgcacgttcgccactggttggcggggagttcgtcgacctgaccgacgcctac
tcaccgcgactgcgggaactcgcccgccaatccgacccgcagctggccgaaggcgtctac
gccggcctgccggggccgcactacgagacaccggcggagatccggatgttgcagacactg
ggcgccgacctggtcggcatgtccacggtgcacgagaccatcgcggcccgggcggcgggc
gctgaggtactgggcgtatccctggtgacaaatctggcggccgggatcaccggcgagccg
ctgagccacgccgaggtgctcgccgccggagccgcatcggcgactcggatgggcgcgctg
ctagccgacgtgatcgcccggttctaa

DBGET integrated database retrieval system