KEGG   Mycobacterium tuberculosis H37Rv: Rv3309cHelp
Entry
Rv3309c           CDS       T00015                                 

Gene name
upp
Definition
(RefSeq) uracil phosphoribosyltransferase
  KO
K00761  uracil phosphoribosyltransferase [EC:2.4.2.9]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
mtu00240  Pyrimidine metabolism
mtu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mtu00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    Rv3309c (upp)
Enzymes [BR:mtu01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.9  uracil phosphoribosyltransferase
     Rv3309c (upp)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: UPRTase Pribosyltran
Motif
Other DBs
NCBI-GeneID: 887944
NCBI-ProteinID: NP_217826
TubercuList: Rv3309c
UniProt: P9WFF3 I6YFR8
Structure
PDB: 

Position
complement(3696470..3697093)
Genome map
AA seq 207 aa AA seqDB search
MQVHVVDHPLAAARLTTLRDERTDNAGFRAALRELTLLLIYEATRDAPCEPVPIRTPLAE
TVGSRLTKPPLLVPVLRAGLGMVDEAHAALPEAHVGFVGVARDEQTHQPVPYLDSLPDDL
TDVPVMVLDPMVATGGSMTHTLGLLISRGAADITVLCVVAAPEGIAALQKAAPNVRLFTA
AIDEGLNEVAYIVPGLGDAGDRQFGPR
NT seq 624 nt NT seq  +upstreamnt  +downstreamnt
gtgcaggtccatgtcgttgaccacccactggccgcggcccgactgaccacgctgcgtgac
gaacgcaccgacaacgccggcttccgggcagcgctgcgcgagctcacgctgctgttgatc
tatgaggccacccgcgatgcgccctgcgagccagtcccgatccgtacgccgctggccgag
acggtcgggtcgcggctaaccaagccacccctgctggttcctgtgttgcgggcggggttg
gggatggtcgacgaggcgcatgccgccttgccggaggcgcacgttggctttgtcggtgtc
gcccgcgacgagcaaacccaccagccggtgccgtatctggactcgctgcccgacgacctg
acggatgtaccggtcatggtgcttgacccgatggtggccaccggcgggtcgatgacgcac
accctcggtctgctgatctcgcgcggtgcagcggatatcacggtgctgtgtgtggttgcg
gcgccagaaggaatcgcggcgctgcagaaggctgcgccaaacgtgcggttgttcactgcg
gccatcgacgaagggcttaacgaggtcgcctacattgtgcccggtctcggcgatgccggc
gatcgccagttcggcccgcgctga

DBGET integrated database retrieval system