KEGG   Mycobacterium tuberculosis H37Rv: Rv3318Help
Entry
Rv3318            CDS       T00015                                 

Gene name
sdhA
Definition
(RefSeq) succinate dehydrogenase flavoprotein subunit
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
mtu00020  Citrate cycle (TCA cycle)
mtu00190  Oxidative phosphorylation
mtu00650  Butanoate metabolism
mtu01100  Metabolic pathways
mtu01110  Biosynthesis of secondary metabolites
mtu01120  Microbial metabolism in diverse environments
mtu01130  Biosynthesis of antibiotics
mtu01200  Carbon metabolism
Module
mtu_M00009  Citrate cycle (TCA cycle, Krebs cycle)
mtu_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
mtu_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:mtu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Rv3318 (sdhA)
   00650 Butanoate metabolism
    Rv3318 (sdhA)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    Rv3318 (sdhA)
Enzymes [BR:mtu01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     Rv3318 (sdhA)
    1.3.5.4  fumarate reductase (quinol)
     Rv3318 (sdhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 Thi4 DAO HI0933_like FAD_oxidored
Motif
Other DBs
NCBI-GeneID: 887639
NCBI-ProteinID: NP_217835
TubercuList: Rv3318
UniProt: O53370
Position
3705000..3706772
Genome map
AA seq 590 aa AA seqDB search
MICQHRYDVVIVGAGGAGMRAAVEAGPRVRTAVLTKLYPTRSHTGAAQGGMCAALANVED
DNWEWHTFDTVKGGDYLADQDAVEIMCKEAIDAVLDLEKMGMPFNRTPEGRIDQRRFGGH
TRDHGKAPVRRACYAADRTGHMILQTLYQNCVKHDVEFFNEFYALDLALTQTPSGPVATG
VIAYELATGDIHVFHAKAVVIATGGSGRMYKTTSNAHTLTGDGIGIVFRKGLPLEDMEFH
QFHPTGLAGLGILISEAVRGEGGRLLNGEGERFMERYAPTIVDLAPRDIVARSMVLEVLE
GRGAGPLKDYVYIDVRHLGEEVLEAKLPDITEFARTYLGVDPVTELVPVYPTCHYLMGGI
PTTVTGQVLRDNTSVVPGLYAAGECACVSVHGANRLGTNSLLDINVFGRRAGIAAASYAQ
GHDFVDMPPNPEAMVVGWVSDILSEHGNERVADIRGALQQSMDNNAAVFRTEETLKQALT
DIHALKERYSRITVHDKGKRFNTDLLEAIELGFLLELAEVTVVGALNRKESRGGHAREDY
PNRDDVNYMRHTMAYKEIGADKEGPELRSDVRLDFKPVVQTRYEPKERKY
NT seq 1773 nt NT seq  +upstreamnt  +downstreamnt
ttgatctgccaacaccgatacgacgtggtgatcgtcggcgcgggcggtgccgggatgcgc
gccgcggtcgaggcgggtccgcgggtgcgtaccgcggtgctgaccaagctgtatcccacc
cgcagccacaccggcgcggcccagggcggcatgtgcgccgcgctggccaacgtcgaggac
gacaactgggagtggcacacgttcgacaccgtcaagggcggcgactatctcgccgaccag
gacgccgtggagatcatgtgcaaggaagccatcgacgcggtgctcgacctggagaagatg
gggatgccgttcaaccgcacccccgagggccgcatcgaccagcgccgcttcggcgggcac
acccgcgaccacggcaaggccccggtgcgccgggcctgctacgcggccgatcgcaccggc
cacatgattctgcagacgctgtatcagaactgcgtcaagcacgacgtcgagttcttcaac
gagttttacgcgctggatttggctttgactcaaacgccgtcgggcccggtggccaccggg
gtgatcgcctacgagctagcgaccggtgacatccatgtctttcacgccaaggccgtcgtg
atcgcgaccggcggctcgggccgcatgtataagaccacgtccaacgcacacaccctgacc
ggcgacggcatcggcatcgtgttccgcaagggacttcccttggaggacatggagtttcac
cagtttcaccctaccggcctggccggtctgggcatcttaatctccgaagcggtgcgcggc
gaaggcggccggctgctcaacggggaaggtgagcgtttcatggagcgctacgccccgacg
atcgtcgacctagcgccccgcgacatcgtcgcccgctcgatggtgctggaagtgctggag
ggacgcggcgccggaccgctcaaggactacgtctacatcgacgtccgccacctgggcgag
gaagtgctcgaggccaagctgcccgacatcaccgagttcgcccgcacctacctgggcgtg
gatccggtcaccgagctggtgccggtctacccgacgtgccactacctgatgggcggcatc
ccgaccacagtcaccgggcaggtgctgcgggacaacaccagcgttgtcccgggcctgtat
gcggccggcgagtgcgcgtgcgtgtcggtgcatggcgccaaccggctgggcaccaactcg
ctgttggatatcaacgtcttcggtcgtcgggccggcatcgccgccgccagttatgcgcag
ggtcacgactttgtcgacatgccgcccaacccggaggccatggtggtgggctgggtcagc
gacatcctgtccgaacacggaaacgagcgggtcgccgacattcgcggggcgctgcagcag
tcgatggacaacaacgccgcggtgttccgcaccgaggagaccctgaagcaggcgctcacc
gacatccacgcgctcaaggagcgctactcccgaatcacggtgcacgacaaggggaaacgc
ttcaacaccgacctgctggaagccatcgagctgggatttttactggagctggccgaggtc
acggtggtcggcgctttgaatcgcaaggagtcccgcggcggtcacgcccgcgaggactat
cccaaccgcgacgacgtcaactacatgcgacacaccatggcctacaaggaaattggggcc
gataaggagggccccgagctgcgcagcgatgtccgccttgatttcaaacccgtcgtgcag
acccgttacgaacccaaggaacggaagtactaa

DBGET integrated database retrieval system