KEGG   Mycobacterium tuberculosis H37Rv: Rv3339cHelp
Entry
Rv3339c           CDS       T00015                                 

Gene name
icd1
Definition
(RefSeq) isocitrate dehydrogenase
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
mtu00020  Citrate cycle (TCA cycle)
mtu00480  Glutathione metabolism
mtu01100  Metabolic pathways
mtu01110  Biosynthesis of secondary metabolites
mtu01120  Microbial metabolism in diverse environments
mtu01130  Biosynthesis of antibiotics
mtu01200  Carbon metabolism
mtu01210  2-Oxocarboxylic acid metabolism
mtu01230  Biosynthesis of amino acids
Module
mtu_M00009  Citrate cycle (TCA cycle, Krebs cycle)
mtu_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:mtu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Rv3339c (icd1)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    Rv3339c (icd1)
Enzymes [BR:mtu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     Rv3339c (icd1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh
Motif
Other DBs
NCBI-GeneID: 888013
NCBI-ProteinID: NP_217856
TubercuList: Rv3339c
UniProt: P9WKL1
Structure
PDB: 

Position
complement(3724615..3725844)
Genome map
AA seq 409 aa AA seqDB search
MSNAPKIKVSGPVVELDGDEMTRVIWKLIKDMLILPYLDIRLDYYDLGIEHRDATDDQVT
IDAAYAIKKHGVGVKCATITPDEARVEEFNLKKMWLSPNGTIRNILGGTIFREPIVISNV
PRLVPGWTKPIVIGRHAFGDQYRATNFKVDQPGTVTLTFTPADGSAPIVHEMVSIPEDGG
VVLGMYNFKESIRDFARASFSYGLNAKWPVYLSTKNTILKAYDGMFKDEFERVYEEEFKA
QFEAAGLTYEHRLIDDMVAACLKWEGGYVWACKNYDGDVQSDTVAQGYGSLGLMTSVLMT
ADGKTVEAEAAHGTVTRHYRQYQAGKPTSTNPIASIFAWTRGLQHRGKLDGTPEVIDFAH
KLESVVIATVESGKMTKDLAILIGPEQDWLNSEEFLDAIADNLEKELAN
NT seq 1230 nt NT seq  +upstreamnt  +downstreamnt
atgtccaacgcacccaagataaaagtcagcggtccggtcgtagagctcgacggtgacgag
atgacccgtgtcatctggaagctcatcaaggacatgcttatccttccctatctcgacatc
cgcttggactattacgacttgggcatcgagcaccgcgacgccaccgacgaccaggtgacg
atcgacgcggcgtatgcgatcaagaaacacggtgtgggcgtaaagtgcgcgacgatcacc
cccgacgaggcccgtgtcgaggaattcaacctgaagaagatgtggctgtcgcccaatggg
acaatccggaacatcttgggcggcacaatctttcgcgaacctatcgtgatttctaatgtg
ccgcgactggttccggggtggaccaagccgatcgtcatcggccggcacgcttttggtgac
caatatcgggcgacgaacttcaaggtcgaccaaccgggcaccgtcacactgactttcacg
cccgccgacggcagcgcgccgatcgtgcacgaaatggtgtccatccccgaggacggcggc
gtcgtgctggggatgtacaacttcaaggaatccatccgggatttcgcgcgcgcgtcgttc
tcctacggcctcaacgcgaaatggccggtatatctgtccaccaagaacaccatcctcaag
gcctacgacgggatgttcaaagacgagttcgagcgcgtctacgaagaggaattcaaggcg
cagttcgaagcggcggggctgacctacgagcatcggttgatcgacgacatggtcgccgcc
tgcctgaaatgggaaggcggttacgtctgggcgtgcaagaactacgacggcgacgtgcag
tcggacaccgtcgcacagggctacggctcgctgggcctgatgacgtcggtgctgatgacg
gccgacggcaagacagtcgaggccgaagccgcccacggcaccgtcacccggcattaccgg
cagtatcaggccggtaaaccgacctcaacaaacccgatcgcgtcgatctttgcctggacc
cgcggattacagcatcgcggcaagctggatggcactcccgaagtcatcgacttcgcccac
aagctggagtccgtcgtcatcgccacggtggagagcgggaagatgaccaaggacctcgcg
atcctcatcggtccggagcaggactggctgaatagcgaggaattcctcgatgcgatcgcc
gacaacctggaaaaggagctggccaattag

DBGET integrated database retrieval system