KEGG   Mycobacterium tuberculosis H37Rv: Rv3341Help
Entry
Rv3341            CDS       T00015                                 

Gene name
metA
Definition
(RefSeq) homoserine O-acetyltransferase
  KO
K00641  homoserine O-acetyltransferase/O-succinyltransferase [EC:2.3.1.31 2.3.1.46]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
mtu00270  Cysteine and methionine metabolism
mtu00920  Sulfur metabolism
mtu01100  Metabolic pathways
mtu01110  Biosynthesis of secondary metabolites
mtu01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:mtu00001]
 09100 Metabolism
  09102 Energy metabolism
   00920 Sulfur metabolism
    Rv3341 (metA)
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    Rv3341 (metA)
Enzymes [BR:mtu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.31  homoserine O-acetyltransferase
     Rv3341 (metA)
    2.3.1.46  homoserine O-succinyltransferase
     Rv3341 (metA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Abhydrolase_1 Abhydrolase_6 Hydrolase_4 DUF4884
Motif
Other DBs
NCBI-GeneID: 888030
NCBI-ProteinID: NP_217858
TubercuList: Rv3341
UniProt: P9WJY9 I6YBV5
Position
3727488..3728627
Genome map
AA seq 379 aa AA seqDB search
MTISDVPTQTLPAEGEIGLIDVGSLQLESGAVIDDVCIAVQRWGKLSPARDNVVVVLHAL
TGDSHITGPAGPGHPTPGWWDGVAGPGAPIDTTRWCAVATNVLGGCRGSTGPSSLARDGK
PWGSRFPLISIRDQVQADVAALAALGITEVAAVVGGSMGGARALEWVVGYPDRVRAGLLL
AVGARATADQIGTQTTQIAAIKADPDWQSGDYHETGRAPDAGLRLARRFAHLTYRGEIEL
DTRFANHNQGNEDPTAGGRYAVQSYLEHQGDKLLSRFDAGSYVILTEALNSHDVGRGRGG
VSAALRACPVPVVVGGITSDRLYPLRLQQELADLLPGCAGLRVVESVYGHDGFLVETEAV
GELIRQTLGLADREGACRR
NT seq 1140 nt NT seq  +upstreamnt  +downstreamnt
atgacgatctccgatgtacccacccagacgctgcccgccgaaggcgaaatcggcctgata
gacgtcggctcgctgcaactggaaagcggggcggtgatcgacgatgtctgtatcgccgtg
caacgctggggcaaattgtcgcccgcacgggacaacgtggtggtggtcttgcacgcgctc
accggcgactcgcacatcactggacccgccggacccggccaccccacccccggctggtgg
gacggggtggccgggccgggtgcgccgattgacaccacccgctggtgcgcggtagctacc
aatgtgctcggcggctgccgcggctccaccgggcccagctcgcttgcccgcgacggaaag
ccttggggctcaagatttccgctgatctcgatacgtgaccaggtgcaggcggacgtcgcg
gcgctggccgcgctgggcatcaccgaggtcgccgccgtcgtcggcggctccatgggcggc
gcccgggccctggaatgggtggtcggctacccggatcgggtccgagccggattgctgctg
gcggtcggtgcgcgtgccaccgcagaccagatcggcacgcagacaacgcaaatcgcggcc
atcaaagccgacccggactggcagagcggcgactaccacgagacggggagggcaccagac
gccgggctgcgactcgcccgccgcttcgcgcacctcacctaccgcggcgagatcgagctc
gacacccggttcgccaaccacaaccagggcaacgaggatccgacggccggcgggcgctac
gcggtgcaaagttatctggaacaccaaggagacaaactgttatcccggttcgacgccggc
agctacgtgattctcaccgaggcgctcaacagccacgacgtcggccgcggccgcggcggg
gtctccgcggctctgcgcgcctgcccggtgccggtggtggtgggcggcatcacctccgac
cggctctacccgctgcgcctgcagcaggagctggccgacctgctgccgggctgcgccggg
ctgcgagtcgtcgagtcggtctacggacacgacggcttcctggtggaaaccgaggccgtg
ggcgaattgatccgccagacactgggattggctgatcgtgaaggcgcgtgtcggcggtga

DBGET integrated database retrieval system