KEGG   Mycobacterium tuberculosis H37Rv: Rv3356cHelp
Entry
Rv3356c           CDS       T00015                                 

Gene name
folD
Definition
(RefSeq) bifunctional methylenetetrahydrofolate dehydrogenase/methenyltetrahydrofolate cyclohydrolase
  KO
K01491  methylenetetrahydrofolate dehydrogenase (NADP+) / methenyltetrahydrofolate cyclohydrolase [EC:1.5.1.5 3.5.4.9]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
mtu00670  One carbon pool by folate
mtu01100  Metabolic pathways
mtu01120  Microbial metabolism in diverse environments
mtu01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:mtu00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    Rv3356c (folD)
Enzymes [BR:mtu01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.5  methylenetetrahydrofolate dehydrogenase (NADP+)
     Rv3356c (folD)
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.9  methenyltetrahydrofolate cyclohydrolase
     Rv3356c (folD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: THF_DHG_CYH_C THF_DHG_CYH
Motif
Other DBs
NCBI-GeneID: 888145
NCBI-ProteinID: NP_217873
TubercuList: Rv3356c
UniProt: P9WG81 I6YBW9
Structure
PDB: 

Position
complement(3769804..3770649)
Genome map
AA seq 281 aa AA seqDB search
MGAIMLDGKATRDEIFGDLKQRVAALDAAGRTPGLGTILVGDDPGSQAYVRGKHADCAKV
GITSIRRDLPADISTATLNETIDELNANPDCTGYIVQLPLPKHLDENAALERVDPAKDAD
GLHPTNLGRLVLGTPAPLPCTPRGIVHLLRRYDISIAGAHVVVIGRGVTVGRPLGLLLTR
RSENATVTLCHTGTRDLPALTRQADIVVAAVGVAHLLTADMVRPGAAVIDVGVSRTDDGL
VGDVHPDVWELAGHVSPNPGGVGPLTRAFLLTNVVELAERR
NT seq 846 nt NT seq  +upstreamnt  +downstreamnt
gtgggcgcgatcatgctggacggcaaggctacccgcgacgagatcttcggtgacctcaag
cagcgggtggccgcattggacgcggcgggccgcacgcccggcttgggcaccatcctggtc
ggtgacgacccggggtcgcaggcctacgtgcgcggtaagcacgctgattgcgccaaggtg
ggcatcacgtcgattcgccgcgacctgcccgccgacatcagcaccgccacgctgaatgag
accatcgacgaactgaacgccaaccccgactgcaccggctacatcgtgcagttgccgttg
cccaagcatctcgacgagaacgcggcgttggagcgcgtcgacccggccaaggacgccgat
gggttgcacccgaccaacctgggccggctggtgctgggcaccccggcgccgctgccgtgt
actccgcgcggcattgtgcacctgctgcggcgctacgacatctcgatcgccggcgcgcat
gtggtcgttatcggtcgtggtgtgacggtgggccggccgctggggctgttgctgacccgg
cgctcggagaatgccacggtgacgttgtgccacaccggtacccgcgacctgcccgcgttg
acccggcaggccgacatcgtcgtggccgcggtcggggtggcgcacctgttgacggctgac
atggtgcgcccgggtgccgcggtaatcgacgtcggcgtcagccgcactgatgacggactg
gtcggcgacgtgcatcccgatgtgtgggagctcgccggccacgtgtcacccaatccgggc
ggcgtgggcccgttgacccgggcgttcttgttgaccaatgtcgtggagctggctgagcgg
cgatga

DBGET integrated database retrieval system