KEGG   Mycobacterium tuberculosis H37Rv: Rv3379cHelp
Entry
Rv3379c           CDS       T00015                                 

Gene name
dxs2
Definition
(RefSeq) 1-deoxy-D-xylulose-5-phosphate synthase
  KO
K01662  1-deoxy-D-xylulose-5-phosphate synthase [EC:2.2.1.7]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
mtu00730  Thiamine metabolism
mtu00900  Terpenoid backbone biosynthesis
mtu01100  Metabolic pathways
mtu01110  Biosynthesis of secondary metabolites
mtu01130  Biosynthesis of antibiotics
Module
mtu_M00096  C5 isoprenoid biosynthesis, non-mevalonate pathway
Brite
KEGG Orthology (KO) [BR:mtu00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    Rv3379c (dxs2)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Rv3379c (dxs2)
Enzymes [BR:mtu01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.7  1-deoxy-D-xylulose-5-phosphate synthase
     Rv3379c (dxs2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DXP_synthase_N Transket_pyr Transketolase_C TPP_enzyme_C PFOR_II E1_dh
Motif
Other DBs
NCBI-GeneID: 888080
NCBI-ProteinID: NP_217896
TubercuList: Rv3379c
UniProt: A0A089QS70 O50408
Position
complement(3793257..3794867)
Genome map
AA seq 536 aa AA seqDB search
MFDTGHQTYPHKLLTGRGKDFATLRQADGLSGYPNRHESPHDWVENSHASVSLAWVDGIA
KALALQGQCDRRVIAVIGDGALTGGVAWEGLNNLGAATRPVIVVLNDNGRSYDPTAGALA
AHLEELRVGTPRGPNLFENMGFTYIGPVDGHNIPDTCAVLRKAAAAARPVVVHAVTSKGR
GYPPAEADERDHMHACGVVDIATGLASTPSQRSWTDVFEDEIARIADDRSDVVGLTAAMR
LPTGLGALSRRYPHRVFDSGIAEQHLLASAAGLAAAGTHPVVAVYSTFLHRAFDQLLFDI
GLHRLPVTLVLDRAGVTGPDGPSHHGLWDLALLACVPGFQIACPRDAPRLRQQLRTAIAT
AAPTAVRFPKGAPGEPITAEHTIGGLDVLHTPPPHWRPDVLLVAVGAMSRPCMDAARCLS
EEQIGVTVVDPQWVWPISPALTELAGRHRITVCVEDAIADVGIGAHLSHHIGRTHPRTRT
YTLGLPPAYIPHASRDHILSSHGLTGPAIRIRCKSLLNALHEVPGPEDHPDSGDSY
NT seq 1611 nt NT seq  +upstreamnt  +downstreamnt
gtgttcgacaccgggcaccaaacctatccgcacaagctgctcaccggccgcggtaaagac
ttcgccacgctgcgccaggccgatggtctatcggggtatcccaaccgccatgaatcgcca
catgactgggtcgagaactcccatgcctcggtcagcctcgcctgggtggacggcatcgcc
aaagcattggccctgcaggggcaatgcgaccgacgtgtcatcgcggtgatcggtgatggc
gccctcaccgggggcgtggcatgggagggcctgaacaacctcggtgccgctacccggccc
gtgatcgtcgtgctcaatgacaatggccgctcctacgaccccaccgctggggctcttgcg
gcacacctagaagaacttcgcgtcggcacaccccgagggccgaacctctttgagaacatg
ggatttacctacatcggtccggtcgatgggcacaacatccccgacacgtgcgcggttcta
cgaaaagcggccgcggcagctaggcccgttgttgttcacgcagtgactagtaagggccgg
ggttatcctccagccgaagctgacgagagggaccatatgcacgcctgcggggtggtcgac
attgccaccggcctcgctagcacacccagtcagcggagctggaccgacgtgttcgaggac
gaaatcgcgcgcattgctgacgaccgatccgacgtcgtcgggctgaccgcggcgatgcgt
ctgcccactggtctaggcgcgctgtcgaggcgatacccgcatcgggtgttcgattcgggc
atcgccgaacaacacctgttggccagcgcggccgggctagctgccgcgggaacccatccc
gttgtcgcggtgtactcgacgtttctgcaccgcgcctttgaccaacttctgttcgacatc
gggctgcaccggttacccgtgacgctggtgctggaccgggctggggtaaccgggcccgac
ggacccagccatcacggtttgtgggatctggcgctgctggcctgcgtgcccgggtttcag
atcgcctgtccgcgcgacgcgcctcggctacgacaacagttgcgtaccgcgatcgcgacc
gcggctcccaccgccgtgcgtttccccaaaggggcgccgggcgaaccgatcacggccgaa
cacaccatcggtggcctcgacgtcttgcatacaccaccaccgcattggcgacccgacgtg
ctcttggtcgcagtgggtgccatgagtcgaccatgcatggacgccgcccggtgcctcagc
gaggagcagatcggggtgacagtcgttgatccacaatgggtctggccaatcagcccggca
ctgaccgagctggctggccgccatcggatcaccgtgtgtgtcgaagatgcgattgccgac
gtgggaatcggcgcgcaccttagccaccacatcgggcggacacacccgcggacgcgcacc
tacacactgggactgccaccggcctacattccccacgccagccgcgaccacatcctttcc
agccacggactcaccggccccgcaatccgcataagatgcaaatcactacttaacgcacta
catgaagtccctggacccgaagaccatcctgattccggcgatagttattaa

DBGET integrated database retrieval system