KEGG   Mycobacterium tuberculosis H37Rv: Rv3396cHelp
Entry
Rv3396c           CDS       T00015                                 

Gene name
guaA
Definition
(RefSeq) GMP synthase
  KO
K01951  GMP synthase (glutamine-hydrolysing) [EC:6.3.5.2]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
mtu00230  Purine metabolism
mtu00983  Drug metabolism - other enzymes
mtu01100  Metabolic pathways
Module
mtu_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:mtu00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    Rv3396c (guaA)
  09111 Xenobiotics biodegradation and metabolism
   00983 Drug metabolism - other enzymes
    Rv3396c (guaA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:mtu01002]
    Rv3396c (guaA)
Enzymes [BR:mtu01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.2  GMP synthase (glutamine-hydrolysing)
     Rv3396c (guaA)
Peptidases [BR:mtu01002]
 Cysteine Peptidases
  Family C26: gamma-glutamyl hydrolase family
   Rv3396c (guaA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GMP_synt_C GATase NAD_synthase Peptidase_C26 tRNA_Me_trans QueC ThiI Asn_synthase HHH_2 ATP_bind_3
Motif
Other DBs
NCBI-GeneID: 887412
NCBI-ProteinID: NP_217913
TubercuList: Rv3396c
UniProt: P9WMS7
Position
complement(3812501..3814078)
Genome map
AA seq 525 aa AA seqDB search
MVQPADIDVPETPARPVLVVDFGAQYAQLIARRVREARVFSEVIPHTASIEEIRARQPVA
LVLSGGPASVYADGAPKLDPALLDLGVPVLGICYGFQAMAQALGGIVAHTGTREYGRTEL
KVLGGKLHSDLPEVQPVWMSHGDAVTAAPDGFDVVASSAGAPVAAFEAFDRRLAGVQYHP
EVMHTPHGQQVLSRFLHDFAGLGAQWTPANIANALIEQVRTQIGDGHAICGLSGGVDSAV
AAALVQRAIGDRLTCVFVDHGLLRAGERAQVQRDFVAATGANLVTVDAAETFLEALSGVS
APEGKRKIIGRQFIRAFEGAVRDVLDGKTAEFLVQGTLYPDVVESGGGSGTANIKSHHNV
GGLPDDLKFTLVEPLRLLFKDEVRAVGRELGLPEEIVARQPFPGPGLGIRIVGEVTAKRL
DTLRHADSIVREELTAAGLDNQIWQCPVVLLADVRSVGVQGDGRTYGHPIVLRPVSSEDA
MTADWTRVPYEVLERISTRITNEVAEVNRVVLDITSKPPATIEWE
NT seq 1578 nt NT seq  +upstreamnt  +downstreamnt
gtggtgcagcctgctgacatcgacgtgcctgagacaccggctcgaccggtgttggtggtc
gacttcggtgcccaatatgcccagttgattgcccgtcgggttcgagaagcacgggttttc
tccgaggtgattccgcacaccgcctcgatcgaggagatcagggcccgtcagccggtggcg
ctcgtgctttccggtggaccggccagtgtctacgccgacggcgctccgaaactcgatccg
gcgctactggacctcggtgtaccggttcttggcatctgctacgggtttcaggccatggcg
caggcgctcggggggatcgtcgcccacaccggcactcgcgaatacggtcggactgaactg
aaagtccttggtggcaaactgcattcggatcttcccgaggttcagccggtatggatgagt
cacggtgacgcggtcacggccgcgccggacggattcgacgtggtggctagcagcgccggt
gccccggtggccgccttcgaggccttcgaccggcgcctggccggggtgcagtatcacccg
gaggtgatgcacaccccacacgggcaacaggtgctcagccggtttttgcacgacttcgcc
gggctcggcgcccagtggacgcccgccaacatcgccaacgcgctgatcgagcaggtgcgc
acccagatcggcgacggccacgccatctgcgggctatccggcggcgtggattccgcggtg
gccgcggccctggtgcagcgggccatcggcgaccggttgacctgtgtcttcgtcgaccac
gggctgttgcgcgccggtgagcgggcgcaggtgcaacgcgatttcgtggccgccaccggc
gccaacctggtcaccgtcgacgcggccgagaccttcctcgaggcgctgtcgggcgtgagc
gcccccgagggcaaacgcaagatcatcggccgtcagttcatccgcgcgttcgagggcgcg
gtgcgggatgtgctggacggtaagactgctgagttcctggtgcagggcacgctgtatccg
gatgtggtggagtccggcgggggcagcggcaccgcgaacatcaagagccaccacaatgtc
ggcggcctgcccgacgacctgaagttcaccctcgttgagccgctgcggctgctgttcaaa
gacgaggtgcgcgcggtcgggcgggagttgggtctgccggaggagatcgtggcgcgccag
ccgtttccgggaccggggttgggtattcggatcgtcggggaggtcaccgccaagcggttg
gatacgctgcggcacgccgattcgatcgtgcgtgaggagctgaccgcggcgggcctggac
aaccagatctggcagtgtccggtggtgctgttggccgatgtccgctcggtgggtgtgcag
ggtgacggtcgcacctatggccacccgattgtgctgcgtccggtgtcgagtgaagacgcg
atgaccgccgactggacccgggtgccctacgaggtgctcgagcgcatctcgacccggatc
accaacgaggtcgccgaggtcaaccgcgtggtgctggacatcaccagcaagccgcccgcc
accatcgagtgggagtag

DBGET integrated database retrieval system