KEGG   Mycobacterium tuberculosis H37Rv: Rv3411cHelp
Entry
Rv3411c           CDS       T00015                                 

Gene name
guaB2
Definition
(RefSeq) inosine-5'-monophosphate dehydrogenase
  KO
K00088  IMP dehydrogenase [EC:1.1.1.205]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
mtu00230  Purine metabolism
mtu00983  Drug metabolism - other enzymes
mtu01100  Metabolic pathways
mtu01110  Biosynthesis of secondary metabolites
Module
mtu_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:mtu00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    Rv3411c (guaB2)
  09111 Xenobiotics biodegradation and metabolism
   00983 Drug metabolism - other enzymes
    Rv3411c (guaB2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mtu04147]
    Rv3411c (guaB2)
Enzymes [BR:mtu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.205  IMP dehydrogenase
     Rv3411c (guaB2)
Exosome [BR:mtu04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   Rv3411c (guaB2)
  Exosomal proteins of breast cancer cells
   Rv3411c (guaB2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IMPDH CBS NMO FMN_dh His_biosynth Glu_synthase
Motif
Other DBs
NCBI-GeneID: 887498
NCBI-ProteinID: NP_217928
TubercuList: Rv3411c
UniProt: P9WKI7 I6X784
Structure
PDB: 

Position
complement(3829930..3831519)
Genome map
AA seq 529 aa AA seqDB search
MSRGMSGLEDSSDLVVSPYVRMGGLTTDPVPTGGDDPHKVAMLGLTFDDVLLLPAASDVV
PATADTSSQLTKKIRLKVPLVSSAMDTVTESRMAIAMARAGGMGVLHRNLPVAEQAGQVE
MVKRSEAGMVTDPVTCRPDNTLAQVDALCARFRISGLPVVDDDGALVGIITNRDMRFEVD
QSKQVAEVMTKAPLITAQEGVSASAALGLLRRNKIEKLPVVDGRGRLTGLITVKDFVKTE
QHPLATKDSDGRLLVGAAVGVGGDAWVRAMMLVDAGVDVLVVDTAHAHNRLVLDMVGKLK
SEVGDRVEVVGGNVATRSAAAALVDAGADAVKVGVGPGSICTTRVVAGVGAPQITAILEA
VAACRPAGVPVIADGGLQYSGDIAKALAAGASTAMLGSLLAGTAEAPGELIFVNGKQYKS
YRGMGSLGAMRGRGGATSYSKDRYFADDALSEDKLVPEGIEGRVPFRGPLSSVIHQLTGG
LRAAMGYTGSPTIEVLQQAQFVRITPAGLKESHPHDVAMTVEAPNYYAR
NT seq 1590 nt NT seq  +upstreamnt  +downstreamnt
atgtcccgtggcatgtccggcctggaagacagctccgacctggtggtcagcccgtacgtt
cgcatgggcggcctgactactgacccggtgcccaccggcggcgacgacccgcacaaggtg
gcgatgctggggctgacattcgacgacgtcttgttgttgccggcggcttccgacgtggtg
cccgccaccgcggatacctccagccagctcaccaagaagatcaggctcaaggtgccactg
gtcagctcggcgatggacaccgtcaccgagtcgcgtatggccatcgcgatggcacgggcg
ggtggcatgggggtgttgcaccgcaacctgcccgttgccgagcaagccggccaggtcgag
atggtgaagcgatccgaggccggcatggtcaccgatcccgtcacctgccggccggacaac
accttggcccaggtcgatgcgctgtgcgcccggttccggatctccgggttgccggtggtc
gacgacgacggtgcgctggtgggcatcatcaccaaccgtgacatgcggtttgaggtcgac
cagtccaagcaggtcgccgaggtgatgaccaaagccccgctgatcaccgctcaagagggt
gtcagtgcgtccgcggcgctgggcctgttgcgccgcaacaagatcgagaagctgcccgtg
gtcgacggccgcggccggctgaccgggctgatcaccgtcaaggacttcgtcaagaccgag
caacacccgctggccaccaaggacagcgacggccggctgctggtgggggcggccgtcggc
gtcggcggcgatgcctgggtgcgcgccatgatgttggtcgacgctggggtcgacgtgctg
gtcgtggacaccgcgcacgcgcacaaccggttggtgctcgacatggtgggcaaactcaag
tccgaagtcggcgaccgggttgaggtggtaggcggcaacgtcgccaccaggtccgcggcc
gcggccctggtcgacgccggagccgacgcggtgaaagtcggcgtggggccggggtcgatc
tgcacgacgagggtggtggccggggtgggcgcgccgcagatcacggcgatcttggaagct
gtagcggcttgtcgtcctgctggcgtgccggtgatcgccgacggcggactgcagtactcc
ggcgacatcgccaaggcgctggccgccggtgcgtcgacggccatgctgggctcgctgctg
gccggcacagccgaggcgcccggtgagctgatcttcgtgaacggcaagcagtacaagagt
tatcgcggcatgggatcactgggtgccatgcgagggcgtgggggggcgacgtcgtattcc
aaggatcgctacttcgccgacgacgcgctgtcggaagacaaactggtgccggaagggatc
gaggggcgggtgccgttccgtggtccgctgtcgtcggtgatccaccagttgaccggtggc
ctgcgcgccgcgatgggctacaccgggtcgcccaccatcgaggtgctacagcaggcgcaa
ttcgtccggatcacacccgcgggcctcaaggagagtcatccccacgacgtcgcgatgacc
gtcgaggcgcccaactactacgcgcgctaa

DBGET integrated database retrieval system