KEGG   Mycobacterium tuberculosis H37Rv: Rv3432cHelp
Entry
Rv3432c           CDS       T00015                                 

Gene name
gadB
Definition
(RefSeq) glutamate decarboxylase GadB
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
mtu00250  Alanine, aspartate and glutamate metabolism
mtu00410  beta-Alanine metabolism
mtu00430  Taurine and hypotaurine metabolism
mtu00650  Butanoate metabolism
mtu01100  Metabolic pathways
mtu01110  Biosynthesis of secondary metabolites
mtu01120  Microbial metabolism in diverse environments
mtu02024  Quorum sensing
Module
mtu_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:mtu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    Rv3432c (gadB)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Rv3432c (gadB)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Rv3432c (gadB)
   00430 Taurine and hypotaurine metabolism
    Rv3432c (gadB)
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    Rv3432c (gadB)
Enzymes [BR:mtu01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     Rv3432c (gadB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5
Motif
Other DBs
NCBI-GeneID: 887580
NCBI-ProteinID: NP_217949
TubercuList: Rv3432c
UniProt: A0A089QSC7 I6YG46
Position
complement(3850372..3851754)
Genome map
AA seq 460 aa AA seqDB search
MSRSHPSVPAHSIAPAYTGRMFTAPVPALRMPDESMDPEAAYRFIHDELMLDGSSRLNLA
TFVTTWMDPEAEKLMAETFDKNMIDKDEYPATAAIEARCVSMVADLFHAEGLRDHDPTSA
TGVSTIGSSEAVMLGGLALKWRWRQRVGSWKGRMPNLVMGSNVQVVWEKFCRYFDVEPRY
LPMERGRYVITPEQVLAAVDENTIGVVAILGTTYTGELEPIAEICAALDKLAAGGGVDVP
VHVDAASGGFVVPFLHPDLVWDFRLPRVVSINVSGHKYGLTYPGVGFVVWRGPEHLPEDL
VFRVNYLGGDMPTFTLNFSRPGNQVVGQYYNFLRLGRDGYTKVMQALSHTARWLGDQLRE
VDHCEVISDGSAIPVVSFRLAGDRGYTEFDVSHELRTFGWQVPAYTMPDNATDVAVLRIV
VREGLSADLARALHDDAVTALAALDKVKPGGHFDAQHFAH
NT seq 1383 nt NT seq  +upstreamnt  +downstreamnt
gtgtctcgcagtcacccgtccgtgcccgcgcattcgatcgctccggcctacaccggtcgg
atgttcaccgcaccggtgccggcgctgcggatgcccgatgagtcgatggatcccgaggcg
gcctatcgcttcatccacgacgagctgatgctcgacggtagctcgcggctgaatctggcc
accttcgtgaccacctggatggacccggaggccgaaaagctgatggccgagacgttcgac
aagaacatgatcgataaggacgaatacccggcgaccgcggccatcgaggcgcgctgtgtg
tccatggtcgccgacctgtttcacgccgagggtctgcgcgaccacgaccccaccagcgcc
accggggtgtccaccatcggctccagcgaggcggtgatgctgggtgggctggccctgaaa
tggcgttggcggcaacgggtggggtcttggaaggggcgcatgcccaatctggtgatgggt
tcgaacgtccaggtggtgtgggagaagttctgccgctacttcgacgtcgaaccccgttac
ctgccgatggagcggggccgctacgtcatcacccccgagcaggtgctcgccgccgtcgac
gagaacaccatcggcgtggtggcgatcttgggcaccacctataccggtgaactcgaaccc
atcgccgagatctgcgccgcgctggacaaactggcggctggcgggggtgtggacgtcccg
gtacacgtcgacgcggccagtgggggctttgtggtgccgtttttgcatccggacctggta
tgggattttcggctgccccgcgtggtgtcgatcaacgtcagcggccacaagtatgggctg
acctatcccggcgtcgggtttgtcgtgtggcgcgggcccgagcacctgccggaggatctg
gttttccgggtcaactacctcggcggcgacatgccgaccttcaccctgaacttctcccgt
cccggtaaccaggtggtgggccagtactacaacttcctgcggctggggcgcgacggctat
accaaggtgatgcaggcgctgtcgcacaccgcccggtggctgggtgaccagctgcgcgag
gtggatcattgcgaggtgatctcggatggttcggcgatcccggtggtcagcttccggctc
gccggcgaccgcgggtacacggagttcgacgtctcccatgagctgcggaccttcgggtgg
caggtgcccgcctacaccatgccggacaacgccaccgacgtggcggtgctgcggatcgtg
gttcgggaaggactctccgccgacctggcgcgggccctgcacgacgacgcggtcaccgcg
ttggctgccctggacaaggtcaagccgggtggccacttcgacgcacagcatttcgcgcac
tag

DBGET integrated database retrieval system