KEGG   Mycobacterium tuberculosis H37Rv: Rv3436cHelp
Entry
Rv3436c           CDS       T00015                                 

Gene name
glmS
Definition
(RefSeq) glucosamine--fructose-6-phosphate aminotransferase
  KO
K00820  glucosamine---fructose-6-phosphate aminotransferase (isomerizing) [EC:2.6.1.16]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
mtu00250  Alanine, aspartate and glutamate metabolism
mtu00520  Amino sugar and nucleotide sugar metabolism
mtu01100  Metabolic pathways
mtu01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:mtu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Rv3436c (glmS)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Rv3436c (glmS)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:mtu01002]
    Rv3436c (glmS)
Enzymes [BR:mtu01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.16  glutamine---fructose-6-phosphate transaminase (isomerizing)
     Rv3436c (glmS)
Peptidases [BR:mtu01002]
 Cysteine Peptidases
  Family C44
   Rv3436c (glmS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SIS GATase_6 GATase_7 SIS_2 GATase_4
Motif
Other DBs
NCBI-GeneID: 887568
NCBI-ProteinID: NP_217953
TubercuList: Rv3436c
UniProt: P9WN49 I6XH78
Position
complement(3855015..3856889)
Genome map
AA seq 624 aa AA seqDB search
MCGIVGYVGRRPAYVVVMDALRRMEYRGYDSSGIALVDGGTLTVRRRAGRLANLEEAVAE
MPSTALSGTTGLGHTRWATHGRPTDRNAHPHRDAAGKIAVVHNGIIENFAVLRRELETAG
VEFASDTDTEVAAHLVARAYRHGETADDFVGSVLAVLRRLEGHFTLVFANADDPGTLVAA
RRSTPLVLGIGDNEMFVGSDVAAFIEHTREAVELGQDQAVVITADGYRISDFDGNDGLQA
GRDFRPFHIDWDLAAAEKGGYEYFMLKEIAEQPAAVADTLLGHFVGGRIVLDEQRLSDQE
LREIDKVFVVACGTAYHSGLLAKYAIEHWTRLPVEVELASEFRYRDPVLDRSTLVVAISQ
SGETADTLEAVRHAKEQKAKVLAICNTNGSQIPRECDAVLYTRAGPEIGVASTKTFLAQI
AANYLLGLALAQARGTKYPDEVEREYHELEAMPDLVARVIAATGPVAELAHRFAQSSTVL
FLGRHVGYPVALEGALKLKELAYMHAEGFAAGELKHGPIALIEDGLPVIVVMPSPKGSAT
LHAKLLSNIREIQTRGAVTIVIAEEGDETVRPYADHLIEIPAVSTLLQPLLSTIPLQVFA
ASVARARGYDVDKPRNLAKSVTVE
NT seq 1875 nt NT seq  +upstreamnt  +downstreamnt
gtgtgcggaattgtcggttacgtcgggcggcgccccgcctacgtcgtcgtcatggacgcg
ctgcgccggatggagtaccgcggctacgactcgtcgggcatcgcgctggtcgacggtggc
acactcaccgtgcgccggcgtgcgggccggctggccaacctcgaggaagccgtggcggaa
atgccgtccacggcgctgtccggtactaccggcctgggccacacccgctgggccacccac
ggtcgtcccaccgaccgcaacgcgcacccgcaccgcgacgctgccggcaagatcgccgtc
gtccacaacggcatcatcgagaacttcgccgtcttgcgccgggagctggagactgccggt
gtcgagtttgccagcgacaccgataccgaggtcgcggcgcacctggtggcgcgggcgtat
cggcacggcgagacggccgatgacttcgtcggctccgtacttgccgtgctgcgccggctt
gaggggcatttcacgctcgtgttcgccaatgccgacgaccccggcaccctcgtggcggcc
cgccgttccacgcccctggtgctgggcatcggcgacaacgagatgttcgtcggttccgac
gtggccgcgtttatcgagcacacccgggaagcggtcgagctcggccaggaccaggcggtg
gtgatcaccgccgacggctaccggatcagcgatttcgacggcaacgatggcctacaagct
gggcgcgatttccgccccttccacatcgactgggatctggctgccgccgaaaagggcggc
tacgagtacttcatgctcaaggagatcgccgagcagcccgccgcggtggccgacaccttg
ctcggacacttcgtgggtggccggatcgtgctcgacgagcagcggttgagcgaccaggaa
ctgcgcgagatcgacaaggtgttcgtggtggcctgcggtaccgcatatcactccgggctg
ctggccaagtacgcgatcgagcactggacgcggctgcccgtggaagtggaactcgccagc
gagtttcggtatcgggatccggtgttggaccgtagcaccttggtggtggcgatctcgcag
tccggggaaaccgccgacacgctggaagcggtccgacacgccaaggagcagaaagccaag
gtgctggcgatctgcaacaccaacggctcgcagatcccgcgcgagtgcgacgcggtgctc
tacacccgcgccggcccggagatcggtgtggcgtccacaaaaacgtttctggcgcagatt
gctgccaactatctgctcggccttgccttggcgcaggcccgcggcaccaaataccccgac
gaggtcgagcgcgagtaccacgaactggaagcgatgccggacctggtggcccgggtgatc
gcggcgaccggaccggtggccgagctggcccaccggttcgcccagtcgtcgaccgtgctg
ttcctgggtcgccatgtcggctatccggtggcgctggagggtgcactcaaactcaaggag
ttggcctacatgcacgccgagggtttcgcggccggcgagctcaagcacggcccgatcgcg
ctgatcgaagacggcctaccggtcatcgtcgtcatgccctcacccaaggggtcggccacg
ctgcacgccaagctgctgtccaacatccgtgaaatccagacccgcggtgcggtgaccatc
gtgatcgccgaggagggcgacgaaacggtgcgcccctacgccgatcacctgatcgaaatc
ccagcggtgtcaacgctattgcagccgctgctatcaaccattccgcttcaggtgttcgcg
gcttcggtggcgcgcgcccgcggctacgatgtcgacaagccgcggaatctggccaagtcc
gtcaccgtcgaatag

DBGET integrated database retrieval system