KEGG   Mycobacterium tuberculosis H37Rv: Rv3490Help
Entry
Rv3490            CDS       T00015                                 

Gene name
otsA
Definition
(RefSeq) trehalose-phosphate synthase
  KO
K00697  trehalose 6-phosphate synthase [EC:2.4.1.15 2.4.1.347]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
mtu00500  Starch and sucrose metabolism
mtu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mtu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Rv3490 (otsA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:mtu01003]
    Rv3490 (otsA)
Enzymes [BR:mtu01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.15  alpha,alpha-trehalose-phosphate synthase (UDP-forming)
     Rv3490 (otsA)
    2.4.1.347  alpha,alpha-trehalose-phosphate synthase (ADP-forming)
     Rv3490 (otsA)
Glycosyltransferases [BR:mtu01003]
 Others
  Trehalose
   Rv3490 (otsA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_transf_20 Glycos_transf_1 Glyco_trans_1_4 Glyco_trans_1_2
Motif
Other DBs
NCBI-GeneID: 888404
NCBI-ProteinID: NP_218007
TubercuList: Rv3490
UniProt: P9WN11 I6Y3N4
Position
3908236..3909738
Genome map
AA seq 500 aa AA seqDB search
MAPSGGQEAQICDSETFGDSDFVVVANRLPVDLERLPDGSTTWKRSPGGLVTALEPVLRR
RRGAWVGWPGVNDDGAEPDLHVLDGPIIQDELELHPVRLSTTDIAQYYEGFSNATLWPLY
HDVIVKPLYHREWWDRYVDVNQRFAEAASRAAAHGATVWVQDYQLQLVPKMLRMLRPDLT
IGFFLHIPFPPVELFMQMPWRTEIIQGLLGADLVGFHLPGGAQNFLILSRRLVGTDTSRG
TVGVRSRFGAAVLGSRTIRVGAFPISVDSGALDHAARDRNIRRRAREIRTELGNPRKILL
GVDRLDYTKGIDVRLKAFSELLAEGRVKRDDTVVVQLATPSRERVESYQTLRNDIERQVG
HINGEYGEVGHPVVHYLHRPAPRDELIAFFVASDVMLVTPLRDGMNLVAKEYVACRSDLG
GALVLSEFTGAAAELRHAYLVNPHDLEGVKDGIEEALNQTEEAGRRRMRSLRRQVLAHDV
DRWAQSFLDALAGAHPRGQG
NT seq 1503 nt NT seq  +upstreamnt  +downstreamnt
atggctccctcgggaggccaggaggcgcagatttgcgattcggagaccttcggggactct
gacttcgtggtggtagccaatcgactgcccgtcgatctggagcgtcttcccgacggcagc
acaacctggaaacgcagccccggaggcttggtcaccgccttggagccggtgctgcggcgt
cggcgcggggcctgggtcggctggcccggcgttaacgacgacggggccgaacccgacctc
cacgtgctggacggccccatcatccaagacgagctggaacttcatccggtacggctgagc
accacggacatagctcagtactacgagggattctccaacgccacactgtggccgctgtac
cacgacgtcatcgtcaagccgctctaccaccgcgaatggtgggatcgctacgtcgacgtc
aaccagcgctttgccgaggccgcgtcgcgcgccgccgcccacggcgcaaccgtgtgggta
caggactaccagctgcagctggtaccgaagatgctgcgcatgctgcggcccgatctgacc
atcggtttctttttgcacatcccgttcccgccggtagagctgtttatgcagatgccgtgg
cgcaccgagatcatccagggcctactgggcgccgacctggtgggcttccatcttccgggc
ggtgcccagaatttcctgatcctgtcccggcgtctggtcggcaccgacacttcccgcgga
accgtcggtgtgcggtcgcggttcggtgcggcggtgctcgggtcccgcaccatacgagtt
ggcgcctttcctatctcggttgactccggcgcgctcgaccacgctgcccgcgaccgcaac
atcaggcgccgggcccgcgagattcgcaccgaactgggaaatccgcgcaagatcctgctc
ggtgttgaccggctcgactacaccaagggcatcgacgtacggctgaaggccttttccgag
ctgctggccgagggccgcgtcaaacgcgacgacaccgtcgtggtccagctggctaccccg
agccgcgagcgggtggagagctaccagacgctgcgcaacgacatcgaacgccaggtcggc
cacattaacggcgagtacggtgaggttggccatccggtagtgcattacctgcatcgaccg
gctccgcgcgacgagcttatcgctttcttcgtggccagcgacgtcatgctggtcacccca
ctacgcgacgggatgaacctggtggccaaggagtacgtcgcttgccgcagcgatcttggc
ggtgccctggtgctcagcgaattcaccggggccgcagccgaactccggcacgcatacctg
gtcaacccgcacgacctggaaggcgtcaaggacgggatagaggaagcgctcaaccagacg
gaggaggcgggccggcggcgaatgcggtcgctgcgacgccaagtgctcgcccacgacgtg
gaccgctgggcacagtcgtttctcgacgctctcgccggggcacacccgaggggccaaggc
taa

DBGET integrated database retrieval system