KEGG   Mycobacterium tuberculosis H37Rv: Rv3502cHelp
Entry
Rv3502c           CDS       T00015                                 

Gene name
hsd4A
Definition
(RefSeq) 3-oxoacyl-ACP reductase
  KO
K00059  3-oxoacyl-[acyl-carrier protein] reductase [EC:1.1.1.100]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
mtu00061  Fatty acid biosynthesis
mtu00780  Biotin metabolism
mtu01100  Metabolic pathways
mtu01130  Biosynthesis of antibiotics
mtu01212  Fatty acid metabolism
Module
mtu_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:mtu00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    Rv3502c (hsd4A)
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    Rv3502c (hsd4A)
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    Rv3502c (hsd4A)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:mtu01004]
    Rv3502c (hsd4A)
Enzymes [BR:mtu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.100  3-oxoacyl-[acyl-carrier-protein] reductase
     Rv3502c (hsd4A)
Lipid biosynthesis proteins [BR:mtu01004]
 Fatty acid synthase
  Component type
   Rv3502c (hsd4A)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short adh_short_C2 KR Omp_AT
Motif
Other DBs
NCBI-GeneID: 887697
NCBI-ProteinID: NP_218019
TubercuList: Rv3502c
UniProt: A0A089QRH3 O53547
Position
complement(3921087..3922040)
Genome map
AA seq 317 aa AA seqDB search
MKLTESNRSPRTTNTTDLSGKVAVVTGAAAGLGRAEALGLARLGATVVVNDVASALDASD
VVDEIGAAAADAGAKAVAVAGDISQRATADELLASAVGLGGLDIVVNNAGITRDRMLFNM
SDEEWDAVIAVHLRGHFLLTRNAAAYWRDKAKDAEGGSVFGRLVNTSSEAGLVGPVGQAN
YAAAKAGITALTLSAARALGRYGVCANVICPRARTAMTADVFGAAPDVEAGQIDPLSPQH
VVSLVQFLASPAAAEVNGQVFIVYGPQVTLVSPPHMERRFSADGTSWDPTELTATLRDYF
AGRDPEQSFSATDLMRQ
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
ttgaaattgactgagtccaatcgctcgccgcgtaccacgaacacgaccgatctgtccgga
aaggtggcggtggtcaccggcgcggccgcgggtttgggtcgggccgaagcgctcggcctg
gcccggttgggcgccaccgtcgtcgtcaacgatgttgcttccgccctggatgcttccgac
gtcgtcgacgagatcggcgccgccgctgccgatgctggtgctaaggccgtcgcggtagcc
ggtgatatcagccagcgcgcgacggccgacgaactgctcgccagcgccgtcgggctgggc
ggactggacatcgtggtgaacaatgccggcatcacccgcgaccggatgctgttcaacatg
tccgacgaggagtgggacgccgtgatcgcggtgcacctgcgcggccattttctgctcacc
cgcaacgccgctgcctactggcgggacaaagccaaggatgccgaagggggatcggtcttc
ggccggctcgtcaacacctcgtcggaggcgggtctggtgggcccggtggggcaggcgaat
tacgccgccgccaaggctggcatcaccgcgctaaccctgtcggcggcgcgggcgctcggg
cgctacggcgtttgcgccaatgtgatttgtccgcgggcgcgcaccgcgatgacggccgat
gtcttcggcgccgcacccgatgtcgaagcgggccagatcgacccgctgtcgccgcagcat
gtggtaagcctggtccagtttctggcgtccccggctgccgcggaagtcaacggtcaggtg
ttcatcgtctacggtccgcaggtgacgctggtgtcaccgccgcacatggagcgccggttc
agcgcggacggcacgtcctgggatcccaccgagctcaccgcgacgctgcgggactacttt
gctggtcgggatccggaacagagcttttcggcgaccgatctgatgcgtcagtga

DBGET integrated database retrieval system