KEGG   Mycobacterium tuberculosis H37Rv: Rv3526Help
Entry
Rv3526            CDS       T00015                                 

Gene name
kshA
Definition
(RefSeq) 3-ketosteroid-9-alpha-monooxygenase oxygenase subunit
  KO
K15982  3-ketosteroid 9alpha-monooxygenase subunit A [EC:1.14.15.30]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
mtu00984  Steroid degradation
mtu01100  Metabolic pathways
mtu01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:mtu00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00984 Steroid degradation
    Rv3526 (kshA)
Enzymes [BR:mtu01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.15  With reduced iron-sulfur protein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.15.30  3-ketosteroid 9alpha-monooxygenase
     Rv3526 (kshA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Rieske
Motif
Other DBs
NCBI-GeneID: 888268
NCBI-ProteinID: NP_218043
TubercuList: Rv3526
UniProt: P71875 I6Y3S4
Structure
PDB: 

Position
3962439..3963599
Genome map
AA seq 386 aa AA seqDB search
MSTDTSGVGVREIDAGALPTRYARGWHCLGVAKDYLEGKPHGVEAFGTKLVVFADSHGDL
KVLDGYCRHMGGDLSEGTVKGDEVACPFHDWRWGGDGRCKLVPYARRTPRMARTRSWTTD
VRSGLLFVWHDHEGNPPDPAVRIPEIPEAASDEWTDWRWNRILIEGSNCRDIIDNVTDMA
HFFYIHFGLPTYFKNVFEGHIASQYLHNVGRPDVDDLGTSYGEAHLDSEASYFGPSFMIN
WLHNRYGNYKSESILINCHYPVTQNSFVLQWGVIVEKPKGMSEEMTDKLSRVFTEGVSKG
FLQDVEIWKHKTRIDNPLLVEEDGAVYQLRRWYEQFYVDVADIKPEMVERFEIEVDTKRA
NEFWNAEVEKNLKSREVSDDVPAEQH
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
gtgagtaccgacacgagtggggtcggtgttcgggagatcgatgccggcgccttgccgacc
aggtatgcgcgtggctggcattgcctgggcgtcgcgaaggactatttggaagggaagcca
cacggggtagaggcgttcggcaccaagctggttgtgttcgctgattcccacggggacctg
aaagtcctcgacggctactgccggcacatgggcggcgacctgtccgagggcaccgtcaaa
ggcgacgaggtcgcttgcccgttccacgactggcgctggggtggcgacggccgctgcaaa
ttggtgccgtatgccaggcgcacacccagaatggcgcgcactcggtcgtggacgaccgat
gtgcgcagcgggctgctgtttgtctggcacgaccatgagggcaatccacccgaccccgcg
gtccggatccccgagattcccgaggcggccagcgacgagtggaccgactggcggtggaac
cgcatcctcatcgaagggtccaactgccgcgacatcatcgacaacgtcaccgatatggcg
cacttcttctacatccacttcggtttgccgacgtacttcaagaacgtcttcgagggccac
atcgcctcgcagtatctgcacaacgtgggccggcccgatgtcgacgatctggggacgtct
tacggtgaggcgcatctggattcggaggcgtcttacttcgggccgtcgttcatgatcaac
tggctgcacaaccgctacggcaactacaagtccgagtcgatcctgatcaactgccactac
ccggtgacccagaactcgttcgtcctgcaatggggcgtcatcgtcgaaaagcccaagggt
atgagcgaagagatgaccgacaagttgtcgcgggtgttcaccgagggcgtcagcaagggc
ttcttgcaggatgtcgagatctggaagcacaagacccgcatcgacaacccgctgctggtt
gaagaggacggcgccgtgtatcagctgcgccgctggtatgaacagttttatgtcgacgta
gccgacataaaaccagagatggtggagcgcttcgagatcgaggtcgacaccaagcgcgcc
aacgagttctggaatgccgaggtagagaagaacttgaaatcgagagaagtttccgacgac
gtgcccgccgagcaacactga

DBGET integrated database retrieval system