KEGG   Mycobacterium tuberculosis H37Rv: Rv3529cHelp
Entry
Rv3529c           CDS       T00015                                 

Definition
(RefSeq) hypothetical protein
Organism
mtu  Mycobacterium tuberculosis H37Rv
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sulfotransfer_3 Sulfotransfer_1 Sulfotransfer_4
Motif
Other DBs
NCBI-GeneID: 888324
NCBI-ProteinID: NP_218046
TubercuList: Rv3529c
UniProt: I6YCC4 A0A089SBG3
Structure
PDB: 

Position
complement(3965884..3967038)
Genome map
AA seq 384 aa AA seqDB search
MTRRPDRKDVATVDELHASATKLVGLDDFGTDDDNYREALGVLLDAYQGEAGLTVLGSKM
NRFFLRGALVARLLSQSAWKQYPEHVDVAIKRPIFVTGLVRTGTTALHRLLGADPAHQGL
HMWLAEYPQPRPPRETWESNPLYRQLDAQFTQHHAENPGYTGLHFMAAYELEECWQLLRQ
SLHSVSYEALAHVPSYADWLSRQDWTPSYCRHRRNLQLIGLNDAEKRWVLKNPSHLFALD
ALMATYPDALVVQTHRPVETIMASMCSLAQHTTEGWSTKFVGAQIGADAMDTWSRGLERF
NAARAKYDSAQFYDVDYHDLIADPLGTVADIYRHFGLTLSDEARQAMTTVHAESQSGARA
PKHSYSLADYGLTVEMVKERFAGL
NT seq 1155 nt NT seq  +upstreamnt  +downstreamnt
atgactcggcgtcccgatcggaaagatgtggccaccgtcgacgaactgcacgcatcggct
accaaactggtgggtctcgacgattttggcaccgacgacgacaactaccgtgaggcgctg
ggtgtgttgctggacgcttaccagggcgaagccggcctcaccgtgttgggcagcaagatg
aaccggttcttcctgcgcggtgcgctggtggccaggctactgtcccagtccgcgtggaag
cagtatccggagcacgtcgacgttgccatcaaacggcctatcttcgtcaccgggttggtg
cgcaccggaaccactgcgctgcaccggctgctgggcgccgacccggcccaccaaggcctg
cacatgtggctggccgagtacccgcagccgcgccccccgcgcgagacctgggagtcaaac
ccgttgtatcgccagctcgatgcacagttcacccagcatcatgccgagaatccgggatac
accggcttgcatttcatggcggcctacgagttggaggagtgttggcagctgttgcggcag
tcgctgcattcggtgtcgtacgaggcgctggcgcatgtacccagctatgccgactggttg
tcacgccaggactggacgccgtcgtattgccggcaccgccgcaacctgcagctgattggg
ctcaacgatgccgaaaagcggtgggtactaaagaatccgagtcatctatttgccctggat
gcgctgatggcgacctatcccgatgccctggtggtgcagactcaccggccggtggagacg
atcatggcgtcgatgtgctcgctggcgcagcacaccacagaagggtggtcgacgaagttt
gtgggcgcccagatcggtgcggacgcgatggacacctggtcgcgtgggctggagcggttc
aatgccgcacgggccaaatatgattcggcccagttctacgacgtggactaccacgacttg
attgccgatccgctgggtacggtggcagatatctaccggcacttcgggttgacgctgtcc
gacgaggctcgacaggcaatgacaaccgtccacgccgagagccagagcggtgcccgggcc
ccaaagcattcctattcgttggctgactacgggctcacggtcgaaatggtcaaagagcgg
ttcgccgggctgtga

DBGET integrated database retrieval system