KEGG   Mycobacterium tuberculosis H37Rv: Rv3565Help
Entry
Rv3565            CDS       T00015                                 

Gene name
aspB
Definition
(RefSeq) aspartate aminotransferase AspB
Organism
mtu  Mycobacterium tuberculosis H37Rv
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 Aminotran_MocR Alliinase_C Aminotran_5 Aminotran_3 Bac_GDH Beta_elim_lyase
Motif
Other DBs
NCBI-GeneID: 888305
NCBI-ProteinID: NP_218082
TubercuList: Rv3565
UniProt: A0A089QVF5 P96847
Structure
PDB: 

Position
4006200..4007366
Genome map
AA seq 388 aa AA seqDB search
MTDRVALRAGVPPFYVMDVWLAAAERQRTHGDLVNLSAGQPSAGAPEPVRAAAAAALHLN
QLGYSVALGIPELRDAIAADYQRRHGITVEPDAVVITTGSSGGFLLAFLACFDAGDRVAM
ASPGYPCYRNILSALGCEVVEIPCGPQTRFQPTAQMLAEIDPPLRGVVVASPANPTGTVI
PPEELAAIASWCDASDVRLISDEVYHGLVYQGAPQTSCAWQTSRNAVVVNSFSKYYAMTG
WRLGWLLVPTVLRRAVDCLTGNFTICPPVLSQIAAVSAFTPEATAEADGNLASYAINRSL
LLDGLRRIGIDRLAPTDGAFYVYADVSDFTSDSLAFCSKLLADTGVAIAPGIDFDTARGG
SFVRISFAGPSGDIEEALRRIGSWLPSQ
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
gtgacggatcgtgtcgccctgcgtgccggcgttcccccgttctacgtgatggacgtctgg
ttggcggccgcggagcgccagcgcacccatggggatctggtgaatctttcggcgggccaa
cccagtgcgggcgctccggaaccggtgcgtgcggccgcggccgccgccctgcatctcaac
cagttgggatactcggtggcgctgggtattccggagctgcgcgacgctatcgccgcggat
taccaacgccggcatggcatcaccgtcgaacccgatgcggtggtgatcaccacgggctcc
tcgggcggctttctgctcgcgtttctggcgtgcttcgacgccggtgatcgggtcgcgatg
gccagtcccggctacccgtgctaccggaatatcctgtcagcgctgggatgtgaggtcgtg
gagatcccgtgcggaccgcagacccgattccaaccgaccgcgcagatgctggccgagatc
gacccaccgctgcgcggtgtcgtcgtcgccagcccggccaacccgaccggaaccgtcatc
ccgcccgaagaactggcggccatcgcgtcgtggtgtgacgcatcggatgtccggttgatc
agtgatgaggtctaccacggcctggtgtaccagggggcaccgcaaaccagctgcgcctgg
cagacgtcgcgaaacgcggtggtagtcaacagcttttccaagtattacgcgatgacgggc
tggcggctgggctggctgctggtgccgacggtgctgcgccgcgcggtggactgcctgacc
ggcaacttcaccatctgcccgccggtcttgtcgcagatcgccgcggtgtccgcgttcacc
ccggaggcgaccgccgaggccgacggcaacctggccagctacgcgatcaaccgctcgctg
ttgctggacggtctgcgtcgcatcggcatcgaccggctggcacccaccgacggcgcattc
tacgtctacgccgacgtctcggacttcaccagcgattcgctggccttctgctcaaagttg
ctggccgacaccggtgttgcgatcgcacccggaatcgatttcgacaccgcacgggggggt
tcgtttgttcggatatcgtttgccgggccaagcggcgacatcgaagaagccttacggcgc
atcggctcctggctgccgagccaatag

DBGET integrated database retrieval system