KEGG   Mycobacterium tuberculosis H37Rv: Rv3601cHelp
Entry
Rv3601c           CDS       T00015                                 

Gene name
panD
Definition
(RefSeq) aspartate 1-decarboxylase
  KO
K01579  aspartate 1-decarboxylase [EC:4.1.1.11]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
mtu00410  beta-Alanine metabolism
mtu00770  Pantothenate and CoA biosynthesis
mtu01100  Metabolic pathways
mtu01110  Biosynthesis of secondary metabolites
Module
mtu_M00119  Pantothenate biosynthesis, valine/L-aspartate => pantothenate
Brite
KEGG Orthology (KO) [BR:mtu00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Rv3601c (panD)
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    Rv3601c (panD)
Enzymes [BR:mtu01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.11  aspartate 1-decarboxylase
     Rv3601c (panD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Asp_decarbox CDC48_N
Motif
Other DBs
NCBI-GeneID: 885596
NCBI-ProteinID: NP_218118
TubercuList: Rv3601c
UniProt: P9WIL3 I6XHN4
Structure
PDB: 

Position
complement(4043862..4044281)
Genome map
AA seq 139 aa AA seqDB search
MLRTMLKSKIHRATVTCADLHYVGSVTIDADLMDAADLLEGEQVTIVDIDNGARLVTYAI
TGERGSGVIGINGAAAHLVHPGDLVILIAYATMDDARARTYQPRIVFVDAYNKPIDMGHD
PAFVPENAGELLDPRLGVG
NT seq 420 nt NT seq  +upstreamnt  +downstreamnt
atgttacggacgatgctgaagtcgaagatccaccgcgccacggtgacctgcgccgacctg
cactacgtcggctcggtgaccatcgatgccgacttgatggacgccgccgacctgctggaa
ggcgaacaggtaaccatcgtcgatatcgacaacggtgctcgactggtcacctacgcgatc
accggcgaacgcggcagtggtgtgattggcatcaacggtgccgccgcgcacttggtgcat
ccgggggatctggtgattctgattgcgtacgcgacgatggacgacgcccgggcccgcaca
taccagccgcggatcgtgtttgtcgacgcttacaacaaaccgatcgacatgggccacgat
ccggcatttgtgcccgaaaacgcgggcgagctgctagacccccggctcggtgtgggatag

DBGET integrated database retrieval system