KEGG   Mycobacterium tuberculosis H37Rv: Rv3602cHelp
Entry
Rv3602c           CDS       T00015                                 

Gene name
panC
Definition
(RefSeq) pantothenate synthetase
  KO
K01918  pantoate--beta-alanine ligase [EC:6.3.2.1]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
mtu00410  beta-Alanine metabolism
mtu00770  Pantothenate and CoA biosynthesis
mtu01100  Metabolic pathways
mtu01110  Biosynthesis of secondary metabolites
Module
mtu_M00119  Pantothenate biosynthesis, valine/L-aspartate => pantothenate
Brite
KEGG Orthology (KO) [BR:mtu00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Rv3602c (panC)
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    Rv3602c (panC)
Enzymes [BR:mtu01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.1  pantoate---beta-alanine ligase (AMP-forming)
     Rv3602c (panC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pantoate_ligase
Motif
Other DBs
NCBI-GeneID: 885459
NCBI-ProteinID: NP_218119
TubercuList: Rv3602c
UniProt: P9WIL5 I6YGM3
Structure
PDB: 

Position
complement(4044281..4045210)
Genome map
AA seq 309 aa AA seqDB search
MTIPAFHPGELNVYSAPGDVADVSRALRLTGRRVMLVPTMGALHEGHLALVRAAKRVPGS
VVVVSIFVNPMQFGAGEDLDAYPRTPDDDLAQLRAEGVEIAFTPTTAAMYPDGLRTTVQP
GPLAAELEGGPRPTHFAGVLTVVLKLLQIVRPDRVFFGEKDYQQLVLIRQLVADFNLDVA
VVGVPTVREADGLAMSSRNRYLDPAQRAAAVALSAALTAAAHAATAGAQAALDAARAVLD
AAPGVAVDYLELRDIGLGPMPLNGSGRLLVAARLGTTRLLDNIAIEIGTFAGTDRPDGYR
AILESHWRN
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atgacgattcctgcgttccatcccggtgaactcaatgtgtactcggcaccgggggatgtc
gccgatgtcagtcgcgcactgcgactcaccggccggcgagtgatgttggtgcctactatg
ggtgcgctgcacgaaggccacctcgcgttggtgcgtgcggccaagcgggtgcccggatcg
gtcgtcgtcgtgtcgatcttcgtcaacccgatgcaattcggtgccggggaagatctcgac
gcctatccccgcaccccggacgacgacctggcgcaactgcgggccgaaggcgtggaaatc
gctttcacgccaactaccgcggcgatgtatcccgacggcctgcgcaccaccgtgcaaccc
ggtccgttggccgccgaactcgagggcggcccgcggccaacccatttcgccggcgtgctg
acggtcgtgctaaagctgctgcagatcgtgcgcccggatcgggtgttcttcggtgagaag
gactaccagcagctggtgctgatccggcagctggtcgcggacttcaacctcgatgtcgcg
gtggtcggcgtgccgaccgtgcgcgaagccgacgggctggcgatgtcgtcgcgcaaccgc
tacctggacccggcccagcgtgcggcggccgtcgcgctctcggcggcgctaacggccgca
gcgcatgcggcaacggctggcgcgcaggccgcgctggatgccgcccgtgcggtgctcgac
gctgcacccggcgtggcggtcgactacctggagctgcgcgatatcgggcttggcccgatg
ccgctcaacggttccggtcggctgctggttgctgcccggcttggcaccaccaggctgctg
gacaacattgcgattgaaatcggaactttcgccggcaccgaccgcccggacggataccgg
gcaatcctcgaatcacattggagaaactga

DBGET integrated database retrieval system