KEGG   Mycobacterium tuberculosis H37Rv: Rv3624cHelp
Entry
Rv3624c           CDS       T00015                                 

Gene name
hpt
Definition
(RefSeq) hypoxanthine-guanine phosphoribosyltransferase
  KO
K00760  hypoxanthine phosphoribosyltransferase [EC:2.4.2.8]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
mtu00230  Purine metabolism
mtu00983  Drug metabolism - other enzymes
mtu01100  Metabolic pathways
mtu01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mtu00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    Rv3624c (hpt)
  09111 Xenobiotics biodegradation and metabolism
   00983 Drug metabolism - other enzymes
    Rv3624c (hpt)
Enzymes [BR:mtu01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.8  hypoxanthine phosphoribosyltransferase
     Rv3624c (hpt)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pribosyltran UPRTase
Motif
Other DBs
NCBI-GeneID: 885398
NCBI-ProteinID: NP_218141
TubercuList: Rv3624c
UniProt: P9WHQ9
Structure
PDB: 

Position
complement(4063254..4063904)
Genome map
AA seq 216 aa AA seqDB search
MTPALVVGPAAWHAVHVTQSSSAITPGQTAELYPGDIKSVLLTAEQIQARIAELGEQIGN
DYRELSATTGQDLLLITVLKGAVLFVTDLARAIPVPTQFEFMAVSSYGSSTSSSGVVRIL
KDLDRDIHGRDVLIVEDVVDSGLTLSWLSRNLTSRNPRSLRVCTLLRKPDAVHANVEIAY
VGFDIPNDFVVGYGLDYDERYRDLSYIGTLDPRVYQ
NT seq 651 nt NT seq  +upstreamnt  +downstreamnt
ttgacgcccgcgttggtcgttggtcccgcggcgtggcacgctgtgcacgtgacccagagc
tcctcggcgatcacccccgggcagacggcggagctttatccgggggacatcaagtcggtg
ctgctcacggccgagcagattcaggcccgcatcgccgagctcggcgagcagatcggcaac
gactaccgcgagctgtccgctaccaccggccaggatctgctgctgatcaccgtgctgaag
ggcgcggtgctcttcgtcaccgacctggcgcgagcgattcccgtgccgacccagttcgag
ttcatggcggtgagttcgtatgggtcatcgacatcctcgtcgggcgtggtgcggatcctc
aaggacctcgaccgcgacatccacggccgcgacgtgctgatcgtcgaggacgtcgtcgac
tccggccttacgctttcgtggttgtcgcggaacctgacgagccggaatccgcggtcattg
cgggtgtgcacgctgctgcgcaagcccgatgcggtgcacgccaacgtcgaaatcgcgtac
gtgggtttcgacattcccaacgacttcgtcgtgggctacggcctggactacgacgaacgc
taccgtgacctgtcatacatcgggacgctggaccccagggtctatcagtag

DBGET integrated database retrieval system