KEGG   Mycobacterium tuberculosis H37Rv: Rv3628Help
Entry
Rv3628            CDS       T00015                                 

Gene name
ppa
Definition
(RefSeq) inorganic pyrophosphatase
  KO
K01507  inorganic pyrophosphatase [EC:3.6.1.1]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
mtu00190  Oxidative phosphorylation
Brite
KEGG Orthology (KO) [BR:mtu00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    Rv3628 (ppa)
Enzymes [BR:mtu01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.1  inorganic diphosphatase
     Rv3628 (ppa)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyrophosphatase
Motif
Other DBs
NCBI-GeneID: 885775
NCBI-ProteinID: NP_218145
TubercuList: Rv3628
UniProt: P9WI55 I6X7X8
Structure
PDB: 

Position
4067423..4067911
Genome map
AA seq 162 aa AA seqDB search
MQFDVTIEIPKGQRNKYEVDHETGRVRLDRYLYTPMAYPTDYGFIEDTLGDDGDPLDALV
LLPQPVFPGVLVAARPVGMFRMVDEHGGDDKVLCVPAGDPRWDHVQDIGDVPAFELDAIK
HFFVHYKDLEPGKFVKAADWVDRAEAEAEVQRSVERFKAGTH
NT seq 489 nt NT seq  +upstreamnt  +downstreamnt
gtgcaattcgacgtgaccatcgaaattcccaagggccagcgcaacaaatacgaggtcgac
catgagacggggcgggttcgtctggaccggtacctgtacaccccgatggcctacccgacc
gactacggcttcatcgaggacaccctaggtgacgatggcgacccgctggacgcgctggtg
ctgctaccgcagccggtcttccccggggtgctggtggcggcgcggccggtggggatgttc
cggatggtcgacgagcacggcggcgacgacaaagtgctgtgcgtcccagccggtgacccc
cggtgggaccacgtccaagacatcggggacgttccggctttcgagctggatgcgatcaag
catttctttgtgcactacaaggacctggaaccaggtaagttcgtcaaggcggccgactgg
gtcgaccgcgccgaagccgaggcagaggtgcagcgttcagtggagcgcttcaaggccggt
acacactga

DBGET integrated database retrieval system