KEGG   Mycobacterium tuberculosis H37Rv: Rv3634cHelp
Entry
Rv3634c           CDS       T00015                                 

Gene name
galE1
Definition
(RefSeq) UDP-glucose 4-epimerase
  KO
K01784  UDP-glucose 4-epimerase [EC:5.1.3.2]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
mtu00052  Galactose metabolism
mtu00520  Amino sugar and nucleotide sugar metabolism
mtu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mtu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    Rv3634c (galE1)
   00520 Amino sugar and nucleotide sugar metabolism
    Rv3634c (galE1)
Enzymes [BR:mtu01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.2  UDP-glucose 4-epimerase
     Rv3634c (galE1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GDP_Man_Dehyd Epimerase 3Beta_HSD RmlD_sub_bind Polysacc_synt_2 NAD_binding_4 NAD_binding_10 adh_short KR NmrA
Motif
Other DBs
NCBI-GeneID: 885765
NCBI-ProteinID: NP_215015
TubercuList: Rv3634c
UniProt: P9WN67 I6YCN0
Position
complement(4072667..4073611)
Genome map
AA seq 314 aa AA seqDB search
MRALVTGAAGFIGSTLVDRLLADGHSVVGLDNFATGRATNLEHLADNSAHVFVEADIVTA
DLHAILEQHRPEVVFHLAAQIDVRRSVADPQFDAAVNVIGTVRLAEAARQTGVRKIVHTS
SGGSIYGTPPEYPTPETAPTDPASPYAAGKVAGEIYLNTFRHLYGLDCSHIAPANVYGPR
QDPHGEAGVVAIFAQALLSGKPTRVFGDGTNTRDYVFVDDVVDAFVRVSADVGGGLRFNI
GTGKETSDRQLHSAVAAAVGGPDDPEFHPPRLGDLKRSCLDIGLAERVLGWRPQIELADG
VRRTVEYFRHKHTD
NT seq 945 nt NT seq  +upstreamnt  +downstreamnt
gtgcgcgcactggtcactggggcggccggattcatcggctcgacgttagtcgaccggttg
ctggcagatggtcattcggtggtgggattggacaacttcgcgaccggccgggcgaccaac
ctcgagcatctggccgacaactccgcacacgtcttcgtcgaagccgacattgtgaccgcc
gatctacacgccatcctcgagcagcaccggcccgaggtggtatttcacctggcggcccag
atcgatgtccgccgttcggtggctgacccgcaattcgacgccgcggtcaatgtcatcggc
acggtgcgcctagccgaggccgcgcggcagaccggtgtccgcaagatcgtgcacacctcc
tcgggaggatcgatctatggcaccccgccggagtatccaacccctgagacagcgcccacc
gatccggcctcgccgtatgccgcgggcaaagtggccggcgaaatctacctgaacaccttt
cgacatctctacggcctggactgctcgcatatcgcaccggctaacgtctacggtcctcgc
caggacccacacggtgaagcgggtgtggtagcgatcttcgcgcaggcgctgctctcgggc
aaacccaccagggtgttcggcgacggcaccaatacgcgcgactatgtgtttgtcgacgac
gtggtcgacgcgtttgtccgggtgtccgcggacgtcggcggtgggctgcgcttcaacatc
ggcaccggtaaggaaacgtcggaccgccaactgcattcggcggtggccgcggctgtcggc
gggcccgacgaccctgagttccacccgccgcggctaggcgatcttaagcggtcctgcctt
gacatcggcttagccgaacgggttttgggctggcgtccgcagatcgagttggccgacggc
gtgcgtcgcacggtcgagtacttccggcacaagcacactgattga

DBGET integrated database retrieval system