KEGG   Mycobacterium tuberculosis H37Rv: Rv3667Help
Entry
Rv3667            CDS       T00015                                 

Gene name
acs
Definition
(RefSeq) acetyl-CoAsynthetase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
mtu00010  Glycolysis / Gluconeogenesis
mtu00620  Pyruvate metabolism
mtu00630  Glyoxylate and dicarboxylate metabolism
mtu00640  Propanoate metabolism
mtu00680  Methane metabolism
mtu01100  Metabolic pathways
mtu01110  Biosynthesis of secondary metabolites
mtu01120  Microbial metabolism in diverse environments
mtu01130  Biosynthesis of antibiotics
mtu01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:mtu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Rv3667 (acs)
   00620 Pyruvate metabolism
    Rv3667 (acs)
   00630 Glyoxylate and dicarboxylate metabolism
    Rv3667 (acs)
   00640 Propanoate metabolism
    Rv3667 (acs)
  09102 Energy metabolism
   00680 Methane metabolism
    Rv3667 (acs)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:mtu01004]
    Rv3667 (acs)
Enzymes [BR:mtu01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Rv3667 (acs)
Lipid biosynthesis proteins [BR:mtu01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Rv3667 (acs)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N
Motif
Other DBs
NCBI-GeneID: 885479
NCBI-ProteinID: NP_218184
TubercuList: Rv3667
UniProt: P9WQD1 I6XHX3
Position
4107792..4109747
Genome map
AA seq 651 aa AA seqDB search
MSESTPEVSSSYPPPAHFAEHANARAELYREAEEDRLAFWAKQANRLSWTTPFTEVLDWS
GAPFAKWFVGGELNVAYNCVDRHVEAGHGDRVAIHWEGEPVGDRRTLTYSDLLAEVSKAA
NALTDLGLVAGDRVAIYLPLIPEAVIAMLACARLGIMHSVVFGGFTAAALQARIVDAQAK
LLITADGQFRRGKPSPLKAAADEALAAIPDCSVEHVLVVRRTGIEMAWSEGRDLWWHHVV
GSASPAHTPEPFDSEHPLFLLYTSGTTGKPKGIMHTSGGYLTQCCYTMRTIFDVKPDSDV
FWCTADIGWVTGHTYGVYGPLCNGVTEVLYEGTPDTPDRHRHFQIIEKYGVTIYYTAPTL
IRMFMKWGREIPDSHDLSSLRLLGSVGEPINPEAWRWYRDVIGGGRTPLVDTWWQTETGS
AMISPLPGIAAAKPGSAMTPLPGISAKIVDDHGDPLPPHTEGAQHVTGYLVLDQPWPSML
RGIWGDPARYWHSYWSKFSDKGYYFAGDGARIDPDGAIWVLGRIDDVMNVSGHRISTAEV
ESALVAHSGVAEAAVVGVTDETTTQAICAFVVLRANYAPHDRTAEELRTEVARVISPIAR
PRDVHVVPELPKTRSGKIMRRLLRDVAENRELGDTSTLLDPTVFDAIRAAK
NT seq 1956 nt NT seq  +upstreamnt  +downstreamnt
gtgagtgagtccacccccgaagtctcctcgtcatacccgccgccagcgcacttcgccgag
cacgcgaacgcccgcgccgagctttaccgcgaggccgaggaagaccggctggctttttgg
gccaagcaggccaaccgactgtcctggacgacgccgttcaccgaggtgttggactggtcg
ggggcgccgttcgccaagtggttcgtgggcggcgagctcaacgtcgcctacaactgtgtg
gatcgtcacgtcgaggccggccatggagatcgggtcgccatccactgggaaggcgagccg
gtcggcgaccggcgcacgctgacctattccgatctgcttgccgaggtatccaaagccgcg
aacgcgctcaccgacctcggtctggtggccggtgaccgcgtcgccatctacctgccgttg
atccctgaggccgtgatcgccatgctggcctgtgcccggctaggcatcatgcatagcgtt
gttttcggcgggttcaccgctgcggccttgcaggcccggatcgtcgacgcccaagccaag
ctgctgatcaccgcggacgggcagtttcggcgcggcaagccatcgcccctcaaggcggcc
gctgacgaggcccttgcagcgatccccgactgctcggtcgagcacgttctggtggtgcgg
cgcacgggaattgagatggcctggagcgagggccgcgacctgtggtggcaccatgtcgtc
ggctcagcttcaccggcacacaccccggagcctttcgattccgagcacccgctgttcctg
ctgtacacgtcaggcaccaccggcaagcccaaaggcattatgcacaccagcggcggctat
ctcactcagtgttgctacacgatgcgcaccattttcgatgtcaagccggacagcgacgtg
ttctggtgcaccgccgacatcggctgggtcaccggccacacctacggcgtctacggcccg
ctgtgcaacggagtcaccgaggttctctacgagggcacgccggatacccccgaccgacac
cggcatttccagatcatcgaaaaatacggcgtgacaatctattacaccgcccccaccctc
atccggatgtttatgaagtggggccgtgagatccccgacagccacgacctgtccagcctg
cggctgctggggtcggtcggcgaaccgatcaaccccgaggcttggcgttggtaccgcgat
gtcatcggcggcggacgcaccccgctggtagacacctggtggcagaccgagaccggctcc
gcgatgatctccccgctgcccggaatcgctgcggccaaaccgggttcagcgatgacgccg
ctgcccgggatctcggccaagatcgtcgacgatcacggtgatccgttgccaccgcacacc
gagggcgcccagcatgttaccgggtacctcgtcctagaccagccgtggccgtcgatgttg
cgcggcatctggggcgaccccgcgcggtattggcactcttactggtccaaattttccgac
aagggctactacttcgccggggacggcgctcgcatagaccccgacggcgcgatctgggta
ctaggccgcatcgacgacgtgatgaacgtgtccgggcaccggatctcgaccgccgaggtg
gaatcggcgctggtcgctcactctggcgtggccgaggcggcggtggtcggggttaccgac
gagaccacgacccaggccatctgtgcgttcgtcgtgctacgcgccaactacgccccccat
gaccgcacagccgaagagttgcgcaccgaagtggctcgagtgatctcgcccatcgcacgg
ccacgcgacgtccacgtagtgcccgaactacccaagactcgtagcggcaaaatcatgcgt
cgactgctgcgcgacgtcgcggaaaaccgtgagcttggcgacacgtcgacgctgctcgat
cccaccgtattcgacgcgatccgggccgccaagtag

DBGET integrated database retrieval system