KEGG   Mycobacterium tuberculosis H37Rv: Rv3709cHelp
Entry
Rv3709c           CDS       T00015                                 

Gene name
ask
Definition
(RefSeq) aspartokinase
  KO
K00928  aspartate kinase [EC:2.7.2.4]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
mtu00260  Glycine, serine and threonine metabolism
mtu00261  Monobactam biosynthesis
mtu00270  Cysteine and methionine metabolism
mtu00300  Lysine biosynthesis
mtu01100  Metabolic pathways
mtu01110  Biosynthesis of secondary metabolites
mtu01120  Microbial metabolism in diverse environments
mtu01130  Biosynthesis of antibiotics
mtu01210  2-Oxocarboxylic acid metabolism
mtu01230  Biosynthesis of amino acids
Module
mtu_M00016  Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
mtu_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:mtu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Rv3709c (ask)
   00270 Cysteine and methionine metabolism
    Rv3709c (ask)
   00300 Lysine biosynthesis
    Rv3709c (ask)
  09110 Biosynthesis of other secondary metabolites
   00261 Monobactam biosynthesis
    Rv3709c (ask)
Enzymes [BR:mtu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.4  aspartate kinase
     Rv3709c (ask)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_kinase ACT ACT_7
Motif
Other DBs
NCBI-GeneID: 885223
NCBI-ProteinID: NP_218226
TubercuList: Rv3709c
UniProt: P9WPX3 I6YGZ1
Structure
PDB: 

Position
complement(4152218..4153483)
Genome map
AA seq 421 aa AA seqDB search
MALVVQKYGGSSVADAERIRRVAERIVATKKQGNDVVVVVSAMGDTTDDLLDLAQQVCPA
PPPRELDMLLTAGERISNALVAMAIESLGAHARSFTGSQAGVITTGTHGNAKIIDVTPGR
LQTALEEGRVVLVAGFQGVSQDTKDVTTLGRGGSDTTAVAMAAALGADVCEIYTDVDGIF
SADPRIVRNARKLDTVTFEEMLEMAACGAKVLMLRCVEYARRHNIPVHVRSSYSDRPGTV
VVGSIKDVPMEDPILTGVAHDRSEAKVTIVGLPDIPGYAAKVFRAVADADVNIDMVLQNV
SKVEDGKTDITFTCSRDVGPAAVEKLDSLRNEIGFSQLLYDDHIGKVSLIGAGMRSHPGV
TATFCEALAAVGVNIELISTSEIRISVLCRDTELDKAVVALHEAFGLGGDEEATVYAGTG
R
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
gtggcgctcgtcgtgcagaagtacggcggatcctcggtggccgacgccgaacggattcgc
cgcgtcgccgaacgcatcgtcgccaccaagaagcaaggcaatgacgtcgtcgtcgtcgtc
tctgccatgggggataccaccgacgacctgctggatctggctcagcaggtgtgcccggcg
ccgccgcctcgggagctggacatgctgcttaccgccggtgaacgcatctcgaatgcgttg
gtggccatggccatcgagtcgctcggcgcgcatgcccggtcgttcaccggttcgcaggcc
ggggtgatcaccaccggcacccacggcaacgccaagatcatcgacgtcacgccggggcgg
ctgcaaaccgcccttgaggaggggcgggtcgttttggtggccggattccaaggggtcagc
caggacaccaaggatgtcacgacgttgggccgcggcggctcggacaccaccgccgtcgcc
atggccgccgcgctgggtgccgatgtctgtgagatctacaccgacgtggacggcatcttc
agcgccgacccgcgcatcgtgcgcaacgcccgaaagctcgacaccgtgaccttcgaggaa
atgctcgagatggcggcctgcggcgccaaggtgctgatgctgcgctgcgtggaatacgct
cgccgccataatattccggtgcacgtccggtcgtcgtactcggacagaccgggcaccgtc
gttgtcggatcgatcaaggacgtacccatggaagaccccatcctgaccggagtcgcgcac
gaccgcagcgaggccaaggtgaccatcgtcgggctgcccgacatccccgggtatgcggcc
aaggtgtttagggcggtggccgacgccgacgtcaacatcgacatggtgctgcagaacgtc
tccaaggtcgaggacggcaagaccgacatcaccttcacctgctcccgcgacgtcgggccc
gccgccgtggaaaaactggactcgctcagaaacgagatcggcttctcacagctgctgtac
gacgaccacatcggcaaggtatcgctgatcggtgccggcatgcgcagccaccccggggtc
accgcgacgttctgtgaggcgctggcggcggtgggggtcaacatcgagctgatctccacc
tcggagatcaggatctcggtgttgtgccgcgacaccgaactggacaaggccgtggtcgcg
ctgcatgaagcgttcgggctcggcggcgacgaggaggccacggtgtacgcggggacggga
cggtag

DBGET integrated database retrieval system