KEGG   Mycobacterium tuberculosis H37Rv: Rv3754Help
Entry
Rv3754            CDS       T00015                                 

Gene name
tyrA
Definition
(RefSeq) prephenate dehydrogenase TyrA
  KO
K04517  prephenate dehydrogenase [EC:1.3.1.12]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
mtu00400  Phenylalanine, tyrosine and tryptophan biosynthesis
mtu00401  Novobiocin biosynthesis
mtu01100  Metabolic pathways
mtu01110  Biosynthesis of secondary metabolites
mtu01130  Biosynthesis of antibiotics
mtu01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mtu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Rv3754 (tyrA)
  09110 Biosynthesis of other secondary metabolites
   00401 Novobiocin biosynthesis
    Rv3754 (tyrA)
Enzymes [BR:mtu01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.12  prephenate dehydrogenase
     Rv3754 (tyrA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PDH F420_oxidored
Motif
Other DBs
NCBI-GeneID: 885559
NCBI-ProteinID: NP_218271
TubercuList: Rv3754
UniProt: O69721
Position
4200421..4201326
Genome map
AA seq 301 aa AA seqDB search
MRAAAAAGREVFGYNRSVEGAHGARSDGFDAITDLNQTLTRAAATEALIVLAVPMPALPG
MLAHIRKSAPGCPLTDVTSVKCAVLDEVTAAGLQARYVGGHPMTGTAHSGWTAGHGGLFN
RAPWVVSVDDHVDPTVWSMVMTLALDCGAMVVPAKSDEHDAAAAAVSHLPHLLAEALAVT
AAEVPLAFALAAGSFRDATRVAATAPDLVRAMCEANTGQLAPAADRIIDLLSRARDSLQS
HGSIADLADAGHAARTRYDSFPRSDIVTVVIGADKWREQLAAAGRAGGVITSALPSLDSP
Q
NT seq 906 nt NT seq  +upstreamnt  +downstreamnt
atgcgggccgccgcagcggcgggccgtgaagtctttggctacaaccggtcggtggagggt
gcccacggcgcccgctccgacgggtttgatgccataaccgatctcaaccaaacgctaacc
cgggccgccgctaccgaggcgttgatcgtgctggccgttccgatgccggccttgccaggc
atgctcgcccatattcgcaaatcggcacctggctgtccgttgaccgacgtcaccagcgtc
aaatgcgcggttctcgacgaggtcacggcggctggtctgcaggcgcgctacgtcggcggt
cacccgatgacgggcaccgcgcactcgggttggaccgccggtcacggcggcttgttcaac
agagccccctgggtggtcagcgtcgatgaccatgtcgaccccacggtgtggtcgatggtg
atgacgctggcgctggactgcggggcgatggtggtgcccgccaaatccgacgagcacgac
gccgccgctgctgccgtctcgcacctgccacacctgctcgctgaggcgctcgccgtcact
gcggccgaggtaccacttgccttcgcgttggctgcagggtctttccgcgatgccacccgg
gtggcagccaccgctcctgacctagtgcgggcaatgtgtgaagctaacaccggccaactg
gcgccggccgcggaccggatcatcgacctgctgagccgtgcgcgtgattcgctgcaatcc
cacggttcgatagccgacctcgccgacgcgggccacgccgcacgcacacgctatgacagc
ttcccgcgctccgacatcgtcaccgtcgttattggcgcggacaaatggcgcgagcaactg
gccgccgcggggcgggcgggcggggtgattacatccgctctgccaagcctggatagtcca
caatga

DBGET integrated database retrieval system