KEGG   Mycobacterium tuberculosis H37Rv: Rv3792Help
Entry
Rv3792            CDS       T00015                                 

Gene name
aftA
Definition
(RefSeq) arabinofuranosyltransferase
  KO
K13686  galactan 5-O-arabinofuranosyltransferase [EC:2.4.2.46]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
mtu00572  Arabinogalactan biosynthesis - Mycobacterium
mtu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mtu00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00572 Arabinogalactan biosynthesis - Mycobacterium
    Rv3792 (aftA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:mtu01003]
    Rv3792 (aftA)
Enzymes [BR:mtu01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.46  galactan 5-O-arabinofuranosyltransferase
     Rv3792 (aftA)
Glycosyltransferases [BR:mtu01003]
 Polysaccharide
  Bacterial polysaccharide
   Rv3792 (aftA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AftA_N AftA_C
Motif
Other DBs
NCBI-GeneID: 886127
NCBI-ProteinID: NP_218309
TubercuList: Rv3792
UniProt: P9WN03
Position
4237932..4239863
Genome map
AA seq 643 aa AA seqDB search
MPSRRKSPQFGHEMGAFTSARAREVLVALGQLAAAVVVAVGVAVVSLLAIARVEWPAFPS
SNQLHALTTVGQVGCLAGLVGIGWLWRHGRFRRLARLGGLVLVSAFTVVTLGMPLGATKL
YLFGISVDQQFRTEYLTRLTDTAALRDMTYIGLPPFYPPGWFWIGGRAAALTGTPAWEMF
KPWAITSMAIAVAVALVLWWRMIRFEYALLVTVATAAVMLAYSSPEPYAAMITVLLPPML
VLTWSGLGARDRQGWAAVVGAGVFLGFAATWYTLLVAYGAFTVVLMALLLAGSRLQSGIK
AAVDPLCRLAVVGAIAAAIGSTTWLPYLLRAARDPVSDTGSAQHYLPADGAALTFPMLQF
SLLGAICLLGTLWLVMRARSSAPAGALAIGVLAVYLWSLLSMLATLARTTLLSFRLQPTL
SVLLVAAGAFGFVEAVQALGKRGRGVIPMAAAIGLAGAIAFSQDIPDVLRPDLTIAYTDT
DGYGQRGDRRPPGSEKYYPAIDAAIRRVTGKRRDRTVVLTADYSFLSYYPYWGFQGLTPH
YANPLAQFDKRATQIDSWSGLSTADEFIAALDKLPWQPPTVFLMRHGAHNSYTLRLAQDV
YPNQPNVRRYTVDLRTALFADPRFVVEDIGPFVLAIRKPQESA
NT seq 1932 nt NT seq  +upstreamnt  +downstreamnt
atgccgagcagacgcaaaagcccccaattcgggcacgaaatgggggcttttacgtctgct
cgcgcccgggaggtgctggtcgctcttggccagctggcagcggcggtggtagtggccgtc
ggtgtcgcggtggtgtccctgctcgccattgcgcgggtggagtggcccgccttcccgtcg
tccaaccagctgcatgcgctgaccaccgtcggccaggtcggctgcctggccgggctggtc
ggcatcggctggttgtggcggcacggtcgattccggcgactggcccggctgggcgggctg
gttttggtatccgcgtttaccgtcgtgacgctgggcatgccgctgggcgccaccaagctg
tatctgttcggcatctctgtcgaccagcagttccgcaccgaatacctcacccggctcacc
gacaccgccgccctgcgcgacatgacctacatcggactgccaccgttttacccaccgggc
tggttctggatcggcggacgcgcggcggcgctgaccgggacgccggcctgggagatgttc
aagccgtgggcgatcacctcgatggccattgcggtggccgtcgcgctggtgctgtggtgg
cggatgatccgcttcgaatacgccttgctggtcaccgtcgccacagcggcggtgatgctg
gcctacagctcgccggagccctacgccgcgatgatcacggtgttgttgccgccgatgctc
gtactgacctggtcgggcctgggcgcgcgcgaccgtcagggctgggccgcggtggtcggt
gccggcgtcttcctgggcttcgcggccacctggtacaccctgttggtcgcctacggcgcg
ttcacggtggtgctgatggcgctgctgctggccgggtcgcggctgcaatccggaatcaag
gcggcggtagacccgctgtgccggcttgccgtcgtcggcgcgatcgcggccgccatcgga
tccaccacctggctgccctacctgctgcgggcggcccgcgacccggtcagcgacaccggc
agcgcccagcactacctacccgcagacggcgccgcactgaccttccccatgctgcagttc
tccctgctgggcgcgatctgtctgctgggcacgctgtggctggtgatgcgcgcgcgatca
tcggcgccagccggcgccctggccatcggcgtgctggccgtctacctgtggtccctgctg
tcgatgctggccacattggcgcgcaccacactgctgtcgtttcgcctgcagccgacgctg
agcgtgctgctggtggcggccggtgcgttcggcttcgtcgaagcggtccaagcccttggc
aaacggggtcgcggtgtcattccgatggccgccgccatcgggttggccggcgcgatcgcg
ttcagccaggacatccccgacgtgttgcggccggacctgaccatcgcctacaccgacacc
gacggctacggccagcgcggcgaccggcgaccgcccggctccgagaagtactacccagcc
atcgatgccgccatccggcgcgtcaccggcaagcgccgcgatcggaccgtcgtgttgacc
gccgactacagcttcctgtcgtactacccctactggggctttcaggggttgacgccgcac
tacgccaacccgctggcacagttcgacaagcgcgccacacagatcgacagctggtcggga
ctctccaccgccgacgagttcatcgccgcgctggacaagctgccctggcagccgccgacc
gtcttcctcatgcgccacggcgcacataacagctacaccctgcggctggcccaggacgtc
taccccaaccagcccaatgttcgccgctacacggtggacctacggaccgccctcttcgcc
gacccgcgtttcgtcgtcgaggacattggcccgttcgtgctggccatccgcaagccgcag
gagagcgcgtga

DBGET integrated database retrieval system