KEGG   Mycobacterium tuberculosis H37Rv: Rv3793Help
Entry
Rv3793            CDS       T00015                                 

Gene name
embC
Definition
(RefSeq) arabinosyltransferase C
  KO
K11387  arabinosyltransferase C [EC:2.4.2.-]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
mtu00571  Lipoarabinomannan (LAM) biosynthesis
Brite
KEGG Orthology (KO) [BR:mtu00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00571 Lipoarabinomannan (LAM) biosynthesis
    Rv3793 (embC)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:mtu01003]
    Rv3793 (embC)
Enzymes [BR:mtu01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.-  
     Rv3793 (embC)
Glycosyltransferases [BR:mtu01003]
 Polysaccharide
  Bacterial polysaccharide
   Rv3793 (embC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Arabinose_trans Arabino_trans_C Arabino_trans_N
Motif
Other DBs
NCBI-GeneID: 886112
NCBI-ProteinID: NP_218310
TubercuList: Rv3793
UniProt: P9WNL5 I6XI75
Structure
PDB: 

Position
4239863..4243147
Genome map
AA seq 1094 aa AA seqDB search
MATEAAPPRIAVRLPSTSVRDAGANYRIARYVAVVAGLLGAVLAIATPLLPVNQTTAQLN
WPQNGTFASVEAPLIGYVATDLNITVPCQAAAGLAGSQNTGKTVLLSTVPKQAPKAVDRG
LLLQRANDDLVLVVRNVPLVTAPLSQVLGPTCQRLTFTAHADRVAAEFVGLVQGPNAEHP
GAPLRGERSGYDFRPQIVGVFTDLAGPAPPGLSFSASVDTRYSSSPTPLKMAAMILGVAL
TGAALVALHILDTADGMRHRRFLPARWWSTGGLDTLVIAVLVWWHFVGANTSDDGYILTM
ARVSEHAGYMANYYRWFGTPEAPFGWYYDLLALWAHVSTASIWMRLPTLAMALTCWWVIS
REVIPRLGHAVKTSRAAAWTAAGMFLAVWLPLDNGLRPEPIIALGILLTWCSVERAVATS
RLLPVAIACIIGALTLFSGPTGIASIGALLVAIGPLRTILHRRSRRFGVLPLVAPILAAA
TVTAIPIFRDQTFAGEIQANLLKRAVGPSLKWFDEHIRYERLFMASPDGSIARRFAVLAL
VLALAVSVAMSLRKGRIPGTAAGPSRRIIGITIISFLAMMFTPTKWTHHFGVFAGLAGSL
GALAAVAVTGAAMRSRRNRTVFAAVVVFVLALSFASVNGWWYVSNFGVPWSNSFPKWRWS
LTTALLELTVLVLLLAAWFHFVANGDGRRTARPTRFRARLAGIVQSPLAIATWLLVLFEV
VSLTQAMISQYPAWSVGRSNLQALAGKTCGLAEDVLVELDPNAGMLAPVTAPLADALGAG
LSEAFTPNGIPADVTADPVMERPGDRSFLNDDGLITGSEPGTEGGTTAAPGINGSRARLP
YNLDPARTPVLGSWRAGVQVPAMLRSGWYRLPTNEQRDRAPLLVVTAAGRFDSREVRLQW
ATDEQAAAGHHGGSMEFADVGAAPAWRNLRAPLSAIPSTATQVRLVADDQDLAPQHWIAL
TPPRIPRVRTLQNVVGAADPVFLDWLVGLAFPCQRPFGHQYGVDETPKWRILPDRFGAEA
NSPVMDHNGGGPLGITELLMRATTVASYLKDDWFRDWGALQRLTPYYPDAQPADLNLGTV
TRSGLWSPAPLRRG
NT seq 3285 nt NT seq  +upstreamnt  +downstreamnt
atggctaccgaagccgccccaccccgtatcgccgtccggctaccatctacctccgtgcgc
gacgcgggagcaaactaccggatcgcccggtacgtcgctgtggtggcgggtctgctaggc
gctgtgctggccatcgccaccccactgctgccggtcaaccagaccaccgcgcaattgaac
tggccccaaaacggcacgttcgccagtgtcgaggcaccgctgattggctacgtggccacc
gacttgaacatcaccgtcccctgccaggccgccgccggactggccggatcgcagaacacc
ggcaagacggtgttgttgtcaacggtgcccaagcaggcgcctaaggccgtcgatcgcggg
ctgctgctgcaacgggccaacgacgacctggtgcttgtggtgcgtaatgtcccgttggtc
accgccccgctgagtcaggtgctcggcccgacctgtcagcggttgacattcaccgcgcac
gccgatcgggtcgccgccgaattcgtcggactggtgcagggacccaatgctgagcacccc
ggtgcaccgctgcgcggtgagcgcagcggctacgacttccgcccgcagatcgtcggggtg
ttcaccgacctggccgggccggcgccaccgggtctgagcttctcggcgagcgtggatacc
cgctacagcagcagccccacgccgctgaagatggccgccatgatcctcggggtagcgctc
accggcgccgccctggtggcgctgcacatcctggacaccgccgacggcatgcggcaccgg
cggttcctgcccgcgcgctggtggtcgaccggcggtctggacaccctggttatcgccgtg
ctggtgtggtggcatttcgtcggggccaacacctccgacgacggctacatcctgaccatg
gcccgggtgtccgagcatgcgggctatatggccaactactaccgctggttcggcacaccc
gaggcgcctttcggctggtactacgacctgctggcgctgtgggctcatgtcagcacggcc
agtatctggatgcgcctacccaccctggcgatggcgctcacctgctggtgggtaatcagc
cgtgaggtcattccccggctggggcacgccgtcaagacgagccgggcagcggcgtggacg
gcggcgggcatgtttctggctgtctggctgccgctggacaacggccttcggcccgagccg
atcatcgccctgggcatcctgctgacctggtgctcggtggagcgggcggtggccaccagc
cggctgctgccggtggcaatcgcctgcatcatcggtgccttgaccctgttctccgggccg
acgggcatcgcctcgatcggtgcgctgctggtcgcgatcgggccgctacggaccatcctg
caccggcgttccaggcggttcggcgtgctaccactggtggcgccgatcctggccgcggcc
accgtcaccgcgatcccgatctttcgtgatcagaccttcgcgggcgagatccaggccaac
ctcctcaagcgtgccgtagggcccagcctgaagtggttcgacgaacacatccgctacgag
cggctgttcatggccagccccgacggctcgatcgcccgccgcttcgccgtgctggccttg
gtgctggcgctcgcggtatcggtggcaatgtcgttacgtaagggccgcattccaggtacc
gctgctggaccgagccgccgcatcatcggcatcacgatcatttccttcctcgcgatgatg
ttcaccccgacaaagtggacccatcacttcggggtgttcgcggggttggccgggtcgctg
ggggcgcttgccgcggtcgcggtgacgggcgctgcgatgcgctcgcggcggaaccggacc
gtgttcgccgccgtggtggtcttcgtgttggccctgtcgttcgccagtgtcaacggctgg
tggtacgtgtccaacttcggtgtgccatggtcgaactcgtttccgaagtggcgatggtcg
cttaccaccgcactcctcgagctgacggtgctggtgctgctgctagcggcatggttccac
ttcgtcgccaacggtgacgggcgccgaacagccaggccaacccggtttagggcacgacta
gccggaattgtccagtccccgttggcaattgccacgtggttgctggtgcttttcgaggtg
gtatcgctgacccaggcgatgatttcccagtacccggcgtggtcggttggccggtctaac
ctacaggctttggccggcaagacctgcgggctggccgaagacgtgctggtggagctggat
cccaacgcaggcatgctggcgccggtgaccgcgccgttggccgacgccctgggagccggc
ctgtctgaagccttcacacccaacggcattcccgccgacgtcaccgccgacccggtgatg
gaacgtccaggggatcgcagtttcctcaacgacgacgggctgatcaccggcagcgaaccc
ggcaccgaagggggcaccacggccgcaccgggaatcaacggctcccgcgcccggctgccc
tacaacctggacccggcccgtacaccggtgctgggcagctggcgagccggcgtgcaggtg
cccgccatgctgcggtcgggctggtaccggctgcccaccaacgagcagcgggacagggcg
ccgctgctggtggtgacggcggccgggcgattcgactcccgcgaggtccggttgcagtgg
gccaccgacgagcaagcggccgccggacaccacggtgggtcgatggaattcgccgacgtc
ggtgccgcgccggcctggcgcaacctgcgcgcaccactgtccgccatcccgagcaccgcc
acccaggtccggttggtcgccgacgaccaggatctggcgccgcagcactggatcgccctc
acaccaccgcggattccgcgggtgcgcacgctgcagaacgtggtgggcgcagcggatccg
gtgttcctggactggctggtggggctggcattcccctgccaacgcccgttcggccaccaa
tacggcgtcgacgagacacccaagtggcggatcctgccggaccggttcggcgccgaagcc
aactcaccggtgatggatcacaatggcggtggcccgctgggcatcaccgagctgctgatg
cgcgcaaccacggtggccagctacctcaaagacgactggtttagggactggggcgcgtta
cagcggttgacgccttactaccccgacgcccagcccgctgatctgaacctaggaacggtg
actcgcagcgggctgtggagtccggcgccgttgcgccgcggctag

DBGET integrated database retrieval system