KEGG   Mycobacterium tuberculosis H37Rv: Rv3818Help
Entry
Rv3818            CDS       T00015                                 

Definition
(RefSeq) hypothetical protein
  KO
K14952  UDP-MurNAc hydroxylase
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
mtu05152  Tuberculosis
Brite
KEGG Orthology (KO) [BR:mtu00001]
 09160 Human Diseases
  09171 Infectious diseases: Bacterial
   05152 Tuberculosis
    Rv3818
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Rieske Lactamase_B_3 Lactamase_B_2
Motif
Other DBs
NCBI-GeneID: 886153
NCBI-ProteinID: NP_218335
TubercuList: Rv3818
UniProt: P9WH21 I6XI97
Position
4282449..4283999
Genome map
AA seq 516 aa AA seqDB search
MQVTSVGHAGFLIQTQAGSILCDPWVNPAYFASWFPFPDNSGLDWGALGECDYLYVSHLH
KDHFDAENLRAHVNKDAVVLLPDFPVPDLRNELQKLGFHRFFETTDSVKHRLRGPNGDLD
VMIIALRAPADGPIGDSALVVADGETTAFNMNDARPVDLDVLASEFGHIDVHMLQYSGAI
WYPMVYDMPARAKDAFGAQKRQRQMDRARQYIAQVGATWVVPSAGPPCFLAPELRHLNDD
GSDPANIFPDQMVFLDQMRAHGQDGGLLMIPGSTADFTGTTLNSLRHPLPAEQVEAIFTT
DKAAYIADYADRMAPVLAAQKAGWAAAAGEPLLQPLRTLFEPIMLQSNEICDGIGYPVEL
AIGPETIVLDFPKRAVREPIPDERFRYGFAIAPELVRTVLRDNEPDWVNTIFLSTRFRAW
RVGGYNEYLYTFFKCLTDERIAYADGWFAEAHDDSSSITLNGWEIQRRCPHLKADLSKFG
VVEGNTLTCNLHGWQWRLDDGRCLTARGHQLRSSRP
NT seq 1551 nt NT seq  +upstreamnt  +downstreamnt
gtgcaggtcacaagcgttggtcacgccggctttctgatccagacccaggccggcagcatc
ctgtgcgacccttgggtcaatccggcctactttgcgtcttggtttccgttccccgacaac
agcgggctggactggggcgctttgggtgagtgcgattatctgtatgtctcgcacctacat
aaggaccacttcgacgcggaaaatctacgagcgcacgtcaacaaggacgccgtcgtgctg
ctgcccgactttccggtacccgacctgcgaaatgagttgcagaagttaggatttcatcgg
ttcttcgaaaccaccgactcggtcaaacaccgcctgaggggacccaacggcgatctcgac
gtgatgatcatcgcactgcgggcccccgccgacggtccgatcggcgactcggcgctagtc
gttgccgacggcgaaacaacggctttcaacatgaacgacgcccgcccggtcgatttggac
gtgctggcatcggagttcggtcacatcgacgtgcatatgctgcagtactcgggcgcgatc
tggtacccgatggtctacgacatgccggcgcgcgcgaaggatgcgttcggcgcccaaaag
cggcaacggcagatggaccgtgctcgccagtacatcgcgcaggtgggagcgacgtgggtg
gtgccgtcggcggggccgccatgctttttagcccccgagctgcgccacctcaacgacgac
ggtagcgatccggccaatatcttccccgaccagatggtgttcctggatcagatgcgggcg
cacggccaggacggcgggctgctgatgatccccggctcgactgcggatttcactggtaca
accctgaattcattgcgccatccactgcccgccgaacaggtcgaggccatctttaccacc
gacaaagccgcatacatcgctgactatgccgaccggatggcgccggtgctcgccgcgcaa
aaggctggctgggccgccgccgccggcgagccactgctgcagccgctgcgcaccctgttc
gagccgatcatgctgcaaagcaacgagatctgcgacggcatcggatacccggtcgagctc
gccatcggtcccgaaaccattgttttggactttccgaaaagagctgtacgagaaccgatt
cccgacgagaggttccgctacgggttcgcgatcgcgccggagctggtgcgcacggtgctg
cgcgacaacgaacccgactgggtcaacaccatcttcttatccacccgatttcgggcatgg
cgggttggtggctacaacgaatacctttacacgttcttcaagtgtctgaccgacgaacgc
atcgcctacgccgacggctggttcgccgaggcccacgatgactcctcatcgatcaccctg
aacggttgggagatccagcgccgctgcccccatctcaaagccgacctatcgaaattcggt
gtggtggaaggcaacacgctcacttgtaacctgcacggctggcagtggcgtctggacgac
ggtcgctgcctcaccgcccggggccatcaactacgcagttcacggccatga

DBGET integrated database retrieval system