KEGG   Mycobacterium tuberculosis H37Rv: Rv3838cHelp
Entry
Rv3838c           CDS       T00015                                 

Gene name
pheA
Definition
(RefSeq) prephenate dehydratase
  KO
K04518  prephenate dehydratase [EC:4.2.1.51]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
mtu00400  Phenylalanine, tyrosine and tryptophan biosynthesis
mtu01100  Metabolic pathways
mtu01110  Biosynthesis of secondary metabolites
mtu01130  Biosynthesis of antibiotics
mtu01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mtu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Rv3838c (pheA)
Enzymes [BR:mtu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.51  prephenate dehydratase
     Rv3838c (pheA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PDT ACT SBP_bac_3
Motif
Other DBs
NCBI-GeneID: 886170
NCBI-ProteinID: NP_218355
TubercuList: Rv3838c
UniProt: P9WIC3 I6XIB6
Position
complement(4311704..4312669)
Genome map
AA seq 321 aa AA seqDB search
MVRIAYLGPEGTFTEAALVRMVAAGLVPETGPDALQRMPVESAPAALAAVRDGGADYACV
PIENSIDGSVLPTLDSLAIGVRLQVFAETTLDVTFSIVVKPGRNAADVRTLAAFPVAAAQ
VRQWLAAHLPAADLRPAYSNADAARQVADGLVDAAVTSPLAAARWGLAALADGVVDESNA
RTRFVLVGRPGPPPARTGADRTSAVLRIDNQPGALVAALAEFGIRGIDLTRIESRPTRTE
LGTYLFFVDCVGHIDDEAVAEALKAVHRRCADVRYLGSWPTGPAAGAQPPLVDEASRWLA
RLRAGKPEQTLVRPDDQGAQA
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
gtggtgcgtatcgcttacctcggtccggaagggacattcaccgaggcagccctggtccgg
atggtggccgccggcctagttcccgagaccgggcccgatgcactgcagcggatgccggtc
gagagcgcgcccgcagcactggctgcggtccgcgacggcggtgcggattatgcgtgcgtg
ccgatcgagaactcgatcgacggttccgtgctgcctactttggatagcctggccatcggt
gtgcgcctgcaggtgttcgccgagacaacgctggacgtgacgttcagcatcgtggtcaaa
cccgggcgcaacgccgcggacgtgcggaccctggcggcctttccggtggcggctgcacag
gtgcggcagtggttggcggcccatcttcccgccgccgacctgcggccggcttattccaac
gcggacgcggcccggcaggtggctgacggcttggttgacgccgcggtgacctcgccgctg
gcggccgctcgttggggattggcggccctggccgacggtgtcgttgacgaatccaatgcc
cgcacccgcttcgtcctggttggtcggcccgggccgcctccggcgcgcaccggagccgat
cgcacgtctgcagtgctgcgcatcgacaaccagcccggtgcgctggtagctgcgctggcc
gagttcggcatccgcggcatcgatctcactcggattgaatcccggcccacccgtaccgaa
cttggcacctatctgttcttcgtggattgcgtcggccacatcgacgacgaggccgtcgcc
gaggcactcaaggcggtgcaccgacgttgtgctgatgtgcgatacctggggtcctggccg
acggggccagcggcaggggcgcagccgcccctggtagacgaagcatcacgctggttagcg
cggctccgcgcgggcaaacccgagcagaccctggttcgcccggacgaccagggggcgcaa
gcatga

DBGET integrated database retrieval system