KEGG   Mycobacterium tuberculosis H37Rv: Rv3913Help
Entry
Rv3913            CDS       T00015                                 

Gene name
trxB2
Definition
(RefSeq) thioredoxin reductase
  KO
K00384  thioredoxin reductase (NADPH) [EC:1.8.1.9]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
mtu00450  Selenocompound metabolism
Brite
KEGG Orthology (KO) [BR:mtu00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    Rv3913 (trxB2)
Enzymes [BR:mtu01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.9  thioredoxin-disulfide reductase
     Rv3913 (trxB2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox DAO GIDA FAD_binding_2 FAD_oxidored K_oxygenase HI0933_like Thi4 NAD_binding_8 Lycopene_cycl FAD_binding_3 NAD_binding_7 Trp_halogenase NAD_binding_9 SnoaL_2
Motif
Other DBs
NCBI-GeneID: 886232
NCBI-ProteinID: NP_218430
TubercuList: Rv3913
UniProt: P9WHH1 I6Y4U2
Structure
PDB: 

Position
4401728..4402735
Genome map
AA seq 335 aa AA seqDB search
MTAPPVHDRAHHPVRDVIVIGSGPAGYTAALYAARAQLAPLVFEGTSFGGALMTTTDVEN
YPGFRNGITGPELMDEMREQALRFGADLRMEDVESVSLHGPLKSVVTADGQTHRARAVIL
AMGAAARYLQVPGEQELLGRGVSSCATCDGFFFRDQDIAVIGGGDSAMEEATFLTRFARS
VTLVHRRDEFRASKIMLDRARNNDKIRFLTNHTVVAVDGDTTVTGLRVRDTNTGAETTLP
VTGVFVAIGHEPRSGLVREAIDVDPDGYVLVQGRTTSTSLPGVFAAGDLVDRTYRQAVTA
AGSGCAAAIDAERWLAEHAATGEADSTDALIGAQR
NT seq 1008 nt NT seq  +upstreamnt  +downstreamnt
atgaccgccccgcctgtccatgaccgcgcacaccaccccgttcgcgacgtgatcgttatc
ggctccggtcccgcggggtacactgcggcgctctacgccgcccgtgcccagctggcgccg
ctggtcttcgagggcacgtctttcggcggcgcgctgatgaccaccaccgacgtggagaac
tacccgggatttcgcaacggcatcaccggtccagagttgatggatgagatgcgggaacag
gcgctgcgattcggcgcggacctgcgtatggaagacgtcgagtcggtatcacttcacggg
ccgctgaaatcggtcgtcaccgccgacggacagacccaccgggcccgagccgtgatcctg
gcaatgggcgcagcggcacgctatctgcaggtgcccggcgaacaggaattgctcgggcgc
ggggtgagctcgtgcgccacctgcgacggattcttcttccgcgatcaggacatcgccgtc
atcggcggcggtgactcggcaatggaggaagctaccttcctgacccgattcgctcgcagt
gtgacgctggtgcatcgccgcgacgagttccgggcttccaaaatcatgctcgatcgcgcc
cgcaacaacgacaagatacggttcctcaccaaccacaccgtggtcgcggtggacggggac
accacagtgaccggcttgcgggtacgcgacaccaacaccggtgccgaaaccaccctgccg
gtaaccggtgttttcgtcgcgatcggccacgagccgcggtcgggcttggtgcgcgaggcc
atcgacgtcgacccggacggctacgtgttggtgcaggggcgtaccaccagcacctcactg
ccgggcgtgttcgctgccggcgacctggtggatcgcacctatcgccaggcggttaccgca
gcgggcagtggctgcgccgcggctatcgacgccgagcgctggctcgccgagcacgcagca
accggagaagctgacagtaccgacgcattgataggagcacaacgatga

DBGET integrated database retrieval system