KEGG   Mycobacterium tuberculosis H37Rv: Rv0129c
Entry
Rv0129c           CDS       T00015                                 

Gene name
fbpC
Definition
(RefSeq) diacylglycerol acyltransferase/mycolyltransferase Ag85C
  KO
K18851  diacylglycerol O-acyltransferase / trehalose O-mycolyltransferase [EC:2.3.1.20 2.3.1.122]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
mtu00561  Glycerolipid metabolism
mtu00572  Arabinogalactan biosynthesis - Mycobacterium
mtu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mtu00001]
 09100 Metabolism
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    Rv0129c (fbpC)
  09107 Glycan biosynthesis and metabolism
   00572 Arabinogalactan biosynthesis - Mycobacterium
    Rv0129c (fbpC)
Enzymes [BR:mtu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.20  diacylglycerol O-acyltransferase
     Rv0129c (fbpC)
    2.3.1.122  trehalose O-mycolyltransferase
     Rv0129c (fbpC)
Motif
Pfam: Esterase
Other DBs
NCBI-GeneID: 886885
NCBI-ProteinID: YP_177694
TubercuList: Rv0129c
UniProt: P9WQN9
Structure
PDB: 

Position
complement(156578..157600)
AA seq 340 aa
MTFFEQVRRLRSAATTLPRRLAIAAMGAVLVYGLVGTFGGPATAGAFSRPGLPVEYLQVP
SASMGRDIKVQFQGGGPHAVYLLDGLRAQDDYNGWDINTPAFEEYYQSGLSVIMPVGGQS
SFYTDWYQPSQSNGQNYTYKWETFLTREMPAWLQANKGVSPTGNAAVGLSMSGGSALILA
AYYPQQFPYAASLSGFLNPSEGWWPTLIGLAMNDSGGYNANSMWGPSSDPAWKRNDPMVQ
IPRLVANNTRIWVYCGNGTPSDLGGDNIPAKFLEGLTLRTNQTFRDTYAADGGRNGVFNF
PPNGTHSWPYWNEQLVAMKADIQHVLNGATPPAAPAAPAA
NT seq 1023 nt   +upstreamnt  +downstreamnt
atgacgttcttcgaacaggtgcgaaggttgcggagcgcagcgacaaccctgccgcgccgg
ctggctatcgcggctatgggggctgtcctggtttacggtctggtcggtaccttcggcggg
ccggccaccgcgggcgcattctctaggcccggtcttccagtggaatatctgcaggtgcca
tccgcgtcgatgggccgcgacatcaaggtccagttccagggcggcggaccgcacgcggtc
tacctgctcgacggtctgcgggcccaggatgactacaacggctgggacatcaacaccccg
gccttcgaggagtactaccagtcagggttgtcggtgatcatgcccgtgggcggccaatcc
agtttctacaccgactggtatcagccctcgcagagcaacggccagaactacacctacaag
tgggagaccttccttaccagagagatgcccgcctggctacaggccaacaagggcgtgtcc
ccgacaggcaacgcggcggtgggtctttcgatgtcgggcggttccgcgctgatcctggcc
gcgtactacccgcagcagttcccgtacgccgcgtcgttgtcgggcttcctcaacccgtcc
gagggctggtggccgacgctgatcggcctggcgatgaacgactcgggcggttacaacgcc
aacagcatgtggggtccgtccagcgacccggcctggaagcgcaacgacccaatggttcag
attccccgcctggtcgccaacaacacccggatctgggtgtactgcggtaacggcacaccc
agcgacctcggcggcgacaacataccggcgaagttcctggaaggcctcaccctgcgcacc
aaccagaccttccgggacacctacgcggccgacggtggacgcaacggggtgtttaacttc
ccgcccaacggaacacactcgtggccctactggaacgagcagctggtcgccatgaaggcc
gatatccagcatgtgctcaacggcgcgacacccccggccgcccctgctgcgccggccgcc
tga

DBGET integrated database retrieval system